BLASTX nr result
ID: Mentha27_contig00037630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00037630 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT05679.1| hypothetical protein F775_05230 [Aegilops tauschii] 57 2e-06 gb|EMT05155.1| hypothetical protein F775_03153 [Aegilops tauschii] 57 3e-06 gb|EMS57641.1| Retrovirus-related Pol polyprotein from transposo... 56 5e-06 >gb|EMT05679.1| hypothetical protein F775_05230 [Aegilops tauschii] Length = 465 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +2 Query: 68 TSRNYYIVDTCRLTLNKDVWMEILLFLPAKSLTRFRSVCKSWLSLISSDQFCRLHI 235 + R ++ C L D+ +E+LL LP KS+ RFR+VC+SW +L+SS FC LH+ Sbjct: 27 SKRKKALLALCARLLPDDMMLEVLLRLPVKSILRFRAVCRSWAALLSSKDFCSLHM 82 >gb|EMT05155.1| hypothetical protein F775_03153 [Aegilops tauschii] Length = 434 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = +2 Query: 74 RNYYIVDTCRLTLNKDVWMEILLFLPAKSLTRFRSVCKSWLSLISSDQFCRLHI 235 R +V C L D+ +E+LL LP KS+ RF++VC+SW +L SS FC LH+ Sbjct: 20 RKKAVVPLCARLLPDDMMLEVLLRLPVKSILRFQAVCRSWAALFSSKDFCSLHM 73 >gb|EMS57641.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Triticum urartu] Length = 1313 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/48 (47%), Positives = 37/48 (77%) Frame = +2 Query: 92 DTCRLTLNKDVWMEILLFLPAKSLTRFRSVCKSWLSLISSDQFCRLHI 235 D+C ++ ++ +E+L +LP KS+ RFR+VC+SW L+SSD+F RLH+ Sbjct: 469 DSCGASIPYEMIIEVLQWLPVKSVFRFRAVCRSWAKLLSSDEFSRLHM 516