BLASTX nr result
ID: Mentha27_contig00036953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00036953 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24069.1| hypothetical protein MIMGU_mgv1a002658mg [Mimulus... 143 3e-32 ref|XP_002277683.2| PREDICTED: pentatricopeptide repeat-containi... 115 8e-24 emb|CBI36037.3| unnamed protein product [Vitis vinifera] 115 8e-24 emb|CAN82028.1| hypothetical protein VITISV_000613 [Vitis vinifera] 115 8e-24 ref|XP_006426850.1| hypothetical protein CICLE_v10025103mg [Citr... 113 2e-23 ref|XP_006465712.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-23 ref|XP_006465711.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-23 ref|XP_004236396.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 ref|NP_683419.1| ABA Overly-Sensitive 5 protein [Arabidopsis tha... 108 8e-22 ref|XP_006343031.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_006392974.1| hypothetical protein EUTSA_v10011294mg [Eutr... 107 2e-21 ref|XP_006306411.1| hypothetical protein CARUB_v10012330mg, part... 106 3e-21 ref|XP_007147463.1| hypothetical protein PHAVU_006G126800g [Phas... 105 9e-21 ref|XP_002894344.1| pentatricopeptide repeat-containing protein ... 105 9e-21 ref|XP_007045547.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma ... 104 1e-20 gb|EXB74598.1| hypothetical protein L484_026295 [Morus notabilis] 104 1e-20 ref|XP_006597666.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_007215014.1| hypothetical protein PRUPE_ppa002515mg [Prun... 102 4e-20 ref|XP_004486474.1| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 ref|XP_002515948.1| pentatricopeptide repeat-containing protein,... 101 1e-19 >gb|EYU24069.1| hypothetical protein MIMGU_mgv1a002658mg [Mimulus guttatus] Length = 649 Score = 143 bits (360), Expect = 3e-32 Identities = 69/87 (79%), Positives = 76/87 (87%) Frame = -1 Query: 261 LMEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLN 82 LMEKL + GNISTVNILIGAF+ VDGL+KC +LLKKW LQLTCYTYKCLLQAYLRA D N Sbjct: 156 LMEKLGSHGNISTVNILIGAFDGVDGLEKCFDLLKKWGLQLTCYTYKCLLQAYLRARDPN 215 Query: 81 RALQIYGKIRRKGYILDSFAYNMLLDA 1 RALQ+Y ++RRKGY LDSF YNMLL A Sbjct: 216 RALQVYRRMRRKGYTLDSFGYNMLLHA 242 >ref|XP_002277683.2| PREDICTED: pentatricopeptide repeat-containing protein At5g39710 [Vitis vinifera] Length = 990 Score = 115 bits (287), Expect = 8e-24 Identities = 51/86 (59%), Positives = 69/86 (80%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 ME+ G+IST+NILIG F +++C +L+KKWDLQ+ CYTYKCLLQA+LR+N+ N+ Sbjct: 1 MERCGVRGSISTINILIGIFGGGADVERCFDLVKKWDLQMNCYTYKCLLQAHLRSNNSNK 60 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A ++Y ++RR+GY LD FAYNMLLDA Sbjct: 61 AFEVYVELRRRGYKLDIFAYNMLLDA 86 >emb|CBI36037.3| unnamed protein product [Vitis vinifera] Length = 646 Score = 115 bits (287), Expect = 8e-24 Identities = 51/86 (59%), Positives = 69/86 (80%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 ME+ G+IST+NILIG F +++C +L+KKWDLQ+ CYTYKCLLQA+LR+N+ N+ Sbjct: 184 MERCGVRGSISTINILIGIFGGGADVERCFDLVKKWDLQMNCYTYKCLLQAHLRSNNSNK 243 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A ++Y ++RR+GY LD FAYNMLLDA Sbjct: 244 AFEVYVELRRRGYKLDIFAYNMLLDA 269 >emb|CAN82028.1| hypothetical protein VITISV_000613 [Vitis vinifera] Length = 790 Score = 115 bits (287), Expect = 8e-24 Identities = 51/86 (59%), Positives = 69/86 (80%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 ME+ G+IST+NILIG F +++C +L+KKWDLQ+ CYTYKCLLQA+LR+N+ N+ Sbjct: 184 MERCGVRGSISTINILIGIFGGGADVERCFDLVKKWDLQMNCYTYKCLLQAHLRSNNSNK 243 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A ++Y ++RR+GY LD FAYNMLLDA Sbjct: 244 AFEVYVELRRRGYKLDIFAYNMLLDA 269 >ref|XP_006426850.1| hypothetical protein CICLE_v10025103mg [Citrus clementina] gi|557528840|gb|ESR40090.1| hypothetical protein CICLE_v10025103mg [Citrus clementina] Length = 656 Score = 113 bits (283), Expect = 2e-23 Identities = 52/86 (60%), Positives = 67/86 (77%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 ME+ T G ISTVNILIG F + L +C+ L+KKWDL++ CYTYKCLLQA+LR+ D++ Sbjct: 156 MERSMTRGTISTVNILIGFFGCSNDLKRCIGLVKKWDLKMNCYTYKCLLQAHLRSRDVHE 215 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A ++YG++R KGY LD F YNMLLDA Sbjct: 216 AFRVYGEMRAKGYKLDIFGYNMLLDA 241 >ref|XP_006465712.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like isoform X2 [Citrus sinensis] Length = 587 Score = 112 bits (280), Expect = 5e-23 Identities = 51/86 (59%), Positives = 67/86 (77%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M++ T G ISTVNILIG F + L +C+ L+KKWDL++ CYTYKCLLQA+LR+ D++ Sbjct: 156 MDRSMTRGTISTVNILIGFFGCSNDLKRCIGLVKKWDLKMNCYTYKCLLQAHLRSRDVHE 215 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A ++YG++R KGY LD F YNMLLDA Sbjct: 216 AFRVYGEMRAKGYKLDIFGYNMLLDA 241 >ref|XP_006465711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like isoform X1 [Citrus sinensis] Length = 656 Score = 112 bits (280), Expect = 5e-23 Identities = 51/86 (59%), Positives = 67/86 (77%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M++ T G ISTVNILIG F + L +C+ L+KKWDL++ CYTYKCLLQA+LR+ D++ Sbjct: 156 MDRSMTRGTISTVNILIGFFGCSNDLKRCIGLVKKWDLKMNCYTYKCLLQAHLRSRDVHE 215 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A ++YG++R KGY LD F YNMLLDA Sbjct: 216 AFRVYGEMRAKGYKLDIFGYNMLLDA 241 >ref|XP_004236396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Solanum lycopersicum] Length = 663 Score = 108 bits (270), Expect = 8e-22 Identities = 53/91 (58%), Positives = 70/91 (76%), Gaps = 5/91 (5%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAF-----NSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRA 94 ME+ GNISTVN+LIG F N V+ L +CL L++KWDL+L CY+YKCLLQAY+R Sbjct: 160 MERTGIRGNISTVNLLIGTFGDGQGNGVNELTRCLGLVQKWDLKLNCYSYKCLLQAYIRL 219 Query: 93 NDLNRALQIYGKIRRKGYILDSFAYNMLLDA 1 + ++AL++Y ++RR+GY LD FAYNMLLDA Sbjct: 220 CNPDKALEVYQQMRRRGYRLDIFAYNMLLDA 250 >ref|NP_683419.1| ABA Overly-Sensitive 5 protein [Arabidopsis thaliana] gi|75216707|sp|Q9ZU27.1|PPR76_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g51965, mitochondrial; Flags: Precursor gi|4220445|gb|AAD12672.1| Similar to gi|3004555 F19F24.14 salt inducible protein homolog from Arabidopsis thaliana BAC gb|AC003673 [Arabidopsis thaliana] gi|332194619|gb|AEE32740.1| ABA Overly-Sensitive 5 protein [Arabidopsis thaliana] Length = 650 Score = 108 bits (270), Expect = 8e-22 Identities = 52/86 (60%), Positives = 64/86 (74%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M K GNISTVNILIG F + + L CL L+KKWDL++ +TYKCLLQAYLR+ D ++ Sbjct: 162 MVKSNVHGNISTVNILIGFFGNTEDLQMCLRLVKKWDLKMNSFTYKCLLQAYLRSRDYSK 221 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A +Y +IRR G+ LD FAYNMLLDA Sbjct: 222 AFDVYCEIRRGGHKLDIFAYNMLLDA 247 >ref|XP_006343031.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Solanum tuberosum] Length = 653 Score = 108 bits (269), Expect = 1e-21 Identities = 53/91 (58%), Positives = 70/91 (76%), Gaps = 5/91 (5%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAF-----NSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRA 94 ME+ GNISTVN+LIG F N V+ L +CL L++KWDL+L CY+YKCLLQAY+R Sbjct: 156 MERTGIQGNISTVNLLIGTFGDGQGNGVNELTRCLGLVQKWDLKLNCYSYKCLLQAYIRL 215 Query: 93 NDLNRALQIYGKIRRKGYILDSFAYNMLLDA 1 + ++AL++Y ++RR+GY LD FAYNMLLDA Sbjct: 216 CNPDKALKVYQEMRRRGYRLDIFAYNMLLDA 246 >ref|XP_006392974.1| hypothetical protein EUTSA_v10011294mg [Eutrema salsugineum] gi|557089552|gb|ESQ30260.1| hypothetical protein EUTSA_v10011294mg [Eutrema salsugineum] Length = 662 Score = 107 bits (267), Expect = 2e-21 Identities = 52/87 (59%), Positives = 64/87 (73%) Frame = -1 Query: 261 LMEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLN 82 LM K GNISTVNILIG F + L CL L+KKW+L++ +TYKCLLQAYLR+ D + Sbjct: 170 LMVKSNVRGNISTVNILIGFFGDTEDLQLCLRLVKKWELKMNSFTYKCLLQAYLRSRDSS 229 Query: 81 RALQIYGKIRRKGYILDSFAYNMLLDA 1 +A +Y +IRR G+ LD FAYNMLLDA Sbjct: 230 KAFDVYCEIRRGGHKLDIFAYNMLLDA 256 >ref|XP_006306411.1| hypothetical protein CARUB_v10012330mg, partial [Capsella rubella] gi|482575122|gb|EOA39309.1| hypothetical protein CARUB_v10012330mg, partial [Capsella rubella] Length = 635 Score = 106 bits (265), Expect = 3e-21 Identities = 51/86 (59%), Positives = 63/86 (73%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M K GNISTVNILIG F + L CL L+KKW+L++ +TYKCLLQAYLR+ D ++ Sbjct: 144 MVKSNVSGNISTVNILIGFFGDTEDLQMCLRLVKKWELKMNSFTYKCLLQAYLRSRDSSK 203 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A +Y +IRR G+ LD FAYNMLLDA Sbjct: 204 AFDVYCEIRRGGHKLDIFAYNMLLDA 229 >ref|XP_007147463.1| hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] gi|561020686|gb|ESW19457.1| hypothetical protein PHAVU_006G126800g [Phaseolus vulgaris] Length = 646 Score = 105 bits (261), Expect = 9e-21 Identities = 49/79 (62%), Positives = 62/79 (78%) Frame = -1 Query: 237 GNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNRALQIYGK 58 G+ISTVNIL+G F S + L++C+ L+KKWDL+L YTYKCLLQAYLR+ D + A Q+Y Sbjct: 161 GSISTVNILVGFFGSGEDLERCVALVKKWDLRLNAYTYKCLLQAYLRSRDSSTAFQVYLD 220 Query: 57 IRRKGYILDSFAYNMLLDA 1 + R+GY LD F YNMLLDA Sbjct: 221 MVRRGYKLDIFGYNMLLDA 239 >ref|XP_002894344.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297340186|gb|EFH70603.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 650 Score = 105 bits (261), Expect = 9e-21 Identities = 51/86 (59%), Positives = 62/86 (72%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M K GNISTVNILIG F + L CL L+KKW L++ +TYKCLLQAYLR+ D ++ Sbjct: 162 MVKSNVHGNISTVNILIGFFGDTEDLQMCLRLVKKWGLKMNSFTYKCLLQAYLRSRDSSK 221 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A +Y +IRR G+ LD FAYNMLLDA Sbjct: 222 AFDVYCEIRRGGHKLDIFAYNMLLDA 247 >ref|XP_007045547.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] gi|590697827|ref|XP_007045548.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] gi|508709482|gb|EOY01379.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] gi|508709483|gb|EOY01380.1| ABA Overly-Sensitive 5 isoform 1 [Theobroma cacao] Length = 648 Score = 104 bits (260), Expect = 1e-20 Identities = 49/86 (56%), Positives = 63/86 (73%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 MEK T GNIS +NILIG F + + LD L+KKW+L++ YTYKCL+QAYLR+ D + Sbjct: 156 MEKSGTRGNISIINILIGFFGNTEDLDTSKMLVKKWELKMNAYTYKCLVQAYLRSRDSGK 215 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A +Y +++RKGY LD F YNMLLDA Sbjct: 216 AFSVYEEMKRKGYKLDVFGYNMLLDA 241 >gb|EXB74598.1| hypothetical protein L484_026295 [Morus notabilis] Length = 656 Score = 104 bits (259), Expect = 1e-20 Identities = 51/86 (59%), Positives = 64/86 (74%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M++ G ISTVNILIG F + L+ CL L+KKW+L +T YTYKCLLQAYLR+ D +R Sbjct: 164 MDRSGVRGTISTVNILIGLFGHCEDLEMCLGLVKKWNLTMTSYTYKCLLQAYLRSYDSSR 223 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A + Y ++RR+G LD FAYNMLLDA Sbjct: 224 AFETYREMRRRGSKLDIFAYNMLLDA 249 >ref|XP_006597666.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Glycine max] Length = 648 Score = 102 bits (255), Expect = 4e-20 Identities = 49/86 (56%), Positives = 64/86 (74%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M++ G+ISTVNIL+G F + + L++C+ L+KKWDL+L YTYKCLLQAYLRA D + Sbjct: 156 MDRRAVRGSISTVNILVGFFGAGEDLERCVSLVKKWDLRLNAYTYKCLLQAYLRALDSST 215 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A ++Y + R GY LD F YNMLLDA Sbjct: 216 AFRVYLDMIRHGYRLDIFGYNMLLDA 241 >ref|XP_007215014.1| hypothetical protein PRUPE_ppa002515mg [Prunus persica] gi|462411164|gb|EMJ16213.1| hypothetical protein PRUPE_ppa002515mg [Prunus persica] Length = 663 Score = 102 bits (255), Expect = 4e-20 Identities = 48/86 (55%), Positives = 61/86 (70%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M++ GNISTVNILIG F + L C+ L+KKW L + CYTYKCLLQA+LR+ + + Sbjct: 171 MDRSNIRGNISTVNILIGLFGDTEDLQTCIGLVKKWCLNMNCYTYKCLLQAFLRSYESTK 230 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A Y ++RR+GY LD F YNMLLDA Sbjct: 231 AFDTYLEMRRRGYKLDIFGYNMLLDA 256 >ref|XP_004486474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g51965, mitochondrial-like [Cicer arietinum] Length = 664 Score = 102 bits (253), Expect = 7e-20 Identities = 51/86 (59%), Positives = 63/86 (73%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 ME+ G+ISTVNILIG F LD+C+ L+KKWDL L YTYKCLLQAYLR++D ++ Sbjct: 176 MERRGVRGSISTVNILIGFFRD---LDRCIGLVKKWDLTLNAYTYKCLLQAYLRSHDSSK 232 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 A +Y + R+GY LD F YNMLLDA Sbjct: 233 AFDVYLDMLRRGYHLDIFGYNMLLDA 258 >ref|XP_002515948.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544853|gb|EEF46368.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 706 Score = 101 bits (252), Expect = 1e-19 Identities = 47/86 (54%), Positives = 65/86 (75%) Frame = -1 Query: 258 MEKLRTIGNISTVNILIGAFNSVDGLDKCLELLKKWDLQLTCYTYKCLLQAYLRANDLNR 79 M+K G ISTVNILIG F + L++C+ L++KWDL++ YTYKCL+QAYLR+ D + Sbjct: 1 MDKNGVRGTISTVNILIGFFGDGEDLERCIGLIEKWDLKMNGYTYKCLVQAYLRSCDSDN 60 Query: 78 ALQIYGKIRRKGYILDSFAYNMLLDA 1 ++Y +++RKGY LD FA+NMLLDA Sbjct: 61 GFRVYLEMKRKGYTLDIFAFNMLLDA 86