BLASTX nr result
ID: Mentha27_contig00036883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00036883 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17690.1| hypothetical protein MIMGU_mgv1a023002mg [Mimulus... 38 8e-06 >gb|EYU17690.1| hypothetical protein MIMGU_mgv1a023002mg [Mimulus guttatus] Length = 908 Score = 38.1 bits (87), Expect(2) = 8e-06 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -3 Query: 376 SIIGMAGIGKTALAQRIYEDPSIS 305 S++GMAGIGKT LA ++EDP IS Sbjct: 188 SLVGMAGIGKTTLAMELFEDPLIS 211 Score = 37.0 bits (84), Expect(2) = 8e-06 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 4/40 (10%) Frame = -1 Query: 312 LYRKRFEYRAFIKVGQKYD----LQTILAQLNPNKDDEME 205 L F+ RAF+ VGQKY+ LQ+ILAQ+NP ++ ++ Sbjct: 209 LISSHFDCRAFVNVGQKYELKSVLQSILAQMNPEIEEVLK 248