BLASTX nr result
ID: Mentha27_contig00036831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00036831 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44742.1| hypothetical protein MIMGU_mgv1a006858mg [Mimulus... 59 7e-07 ref|XP_002458458.1| hypothetical protein SORBIDRAFT_03g034000 [S... 58 1e-06 ref|XP_006646303.1| PREDICTED: protein farnesyltransferase subun... 58 2e-06 ref|XP_004969880.1| PREDICTED: protein farnesyltransferase subun... 58 2e-06 ref|XP_004969879.1| PREDICTED: protein farnesyltransferase subun... 58 2e-06 tpg|DAA57745.1| TPA: hypothetical protein ZEAMMB73_136151 [Zea m... 58 2e-06 gb|ACN28430.1| unknown [Zea mays] gi|414880617|tpg|DAA57748.1| T... 58 2e-06 gb|EEE55352.1| hypothetical protein OsJ_03383 [Oryza sativa Japo... 58 2e-06 gb|EEC71444.1| hypothetical protein OsI_03661 [Oryza sativa Indi... 58 2e-06 ref|NP_001140519.1| uncharacterized protein LOC100272584 [Zea ma... 58 2e-06 ref|NP_001044183.1| Os01g0737800 [Oryza sativa Japonica Group] g... 58 2e-06 dbj|BAD87023.1| putative farnesyltransferase beta subunit [Oryza... 58 2e-06 dbj|BAK05925.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 3e-06 ref|XP_004489283.1| PREDICTED: protein farnesyltransferase subun... 56 6e-06 >gb|EYU44742.1| hypothetical protein MIMGU_mgv1a006858mg [Mimulus guttatus] Length = 429 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 +MGPYSN++EPVHPL+N+VLDKY+EA+ FFA Sbjct: 397 VMGPYSNLLEPVHPLYNIVLDKYYEAHEFFA 427 >ref|XP_002458458.1| hypothetical protein SORBIDRAFT_03g034000 [Sorghum bicolor] gi|241930433|gb|EES03578.1| hypothetical protein SORBIDRAFT_03g034000 [Sorghum bicolor] Length = 451 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/31 (67%), Positives = 30/31 (96%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY+FF+ Sbjct: 419 VLGPYSNLLEPIHPLYNVVLDKYHTAYDFFS 449 >ref|XP_006646303.1| PREDICTED: protein farnesyltransferase subunit beta-like [Oryza brachyantha] Length = 448 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 416 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 446 >ref|XP_004969880.1| PREDICTED: protein farnesyltransferase subunit beta-like isoform X2 [Setaria italica] Length = 449 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 417 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 447 >ref|XP_004969879.1| PREDICTED: protein farnesyltransferase subunit beta-like isoform X1 [Setaria italica] Length = 452 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 420 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 450 >tpg|DAA57745.1| TPA: hypothetical protein ZEAMMB73_136151 [Zea mays] Length = 419 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 387 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 417 >gb|ACN28430.1| unknown [Zea mays] gi|414880617|tpg|DAA57748.1| TPA: hypothetical protein ZEAMMB73_136151 [Zea mays] Length = 297 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 265 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 295 >gb|EEE55352.1| hypothetical protein OsJ_03383 [Oryza sativa Japonica Group] Length = 474 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 443 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 473 >gb|EEC71444.1| hypothetical protein OsI_03661 [Oryza sativa Indica Group] Length = 449 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 418 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 448 >ref|NP_001140519.1| uncharacterized protein LOC100272584 [Zea mays] gi|194699828|gb|ACF83998.1| unknown [Zea mays] Length = 452 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 420 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 450 >ref|NP_001044183.1| Os01g0737800 [Oryza sativa Japonica Group] gi|113533714|dbj|BAF06097.1| Os01g0737800 [Oryza sativa Japonica Group] gi|215706924|dbj|BAG93384.1| unnamed protein product [Oryza sativa Japonica Group] Length = 478 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 447 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 477 >dbj|BAD87023.1| putative farnesyltransferase beta subunit [Oryza sativa Japonica Group] Length = 450 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFA 120 ++GPYSN++EP+HPL+N+VLDKYH AY FF+ Sbjct: 419 VLGPYSNLLEPIHPLYNVVLDKYHTAYEFFS 449 >dbj|BAK05925.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 455 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/32 (65%), Positives = 30/32 (93%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFAG 117 ++GPYSN++EP+HPL+N+VL+KY EAY FF+G Sbjct: 423 MLGPYSNLLEPIHPLYNVVLEKYEEAYEFFSG 454 >ref|XP_004489283.1| PREDICTED: protein farnesyltransferase subunit beta-like [Cicer arietinum] Length = 448 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/32 (65%), Positives = 29/32 (90%) Frame = -2 Query: 212 IMGPYSNMVEPVHPLHNLVLDKYHEAYNFFAG 117 +MGPYSN++EP+HPL N+VL++Y EA+ FFAG Sbjct: 416 VMGPYSNLLEPIHPLFNVVLERYREAHKFFAG 447