BLASTX nr result
ID: Mentha27_contig00036761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00036761 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30835.1| hypothetical protein MIMGU_mgv1a000647mg [Mimulus... 64 3e-08 ref|XP_007046506.1| Transducin/WD40 repeat-like superfamily prot... 60 4e-07 ref|XP_007046505.1| Transducin/WD40 repeat-like superfamily prot... 60 4e-07 ref|XP_007046504.1| Transducin/WD40 repeat-like superfamily prot... 60 4e-07 ref|XP_007046503.1| Transducin/WD40 repeat-like superfamily prot... 60 4e-07 ref|XP_007204792.1| hypothetical protein PRUPE_ppa017381mg, part... 59 9e-07 ref|XP_004287725.1| PREDICTED: uncharacterized protein LOC101298... 56 6e-06 >gb|EYU30835.1| hypothetical protein MIMGU_mgv1a000647mg [Mimulus guttatus] Length = 1032 Score = 63.5 bits (153), Expect = 3e-08 Identities = 35/57 (61%), Positives = 39/57 (68%) Frame = -2 Query: 221 KKGIFASVIKDNKSAKSRNGHEAETQDCRKSIEELSTIFSIANFARDVETEEKKIVN 51 KKGIF+SV+KDNKS KSRNG E E + S+EELS IFS NF D ET EK N Sbjct: 843 KKGIFSSVMKDNKSIKSRNGLEVENE---LSVEELSAIFSAVNFPIDCETSEKSTRN 896 >ref|XP_007046506.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma cacao] gi|508698767|gb|EOX90663.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma cacao] Length = 1011 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = -2 Query: 221 KKGIFASVIKDNKSAKSRNGHEAETQDCRKSIEELSTIFSIANFARDVETEEKK 60 KKGIF SV+K+ K +K ++ HE ET+D R+SIE+LSTIFS ANF +VE + + Sbjct: 862 KKGIFGSVLKEMKGSK-KHVHEVETEDTRESIEQLSTIFSTANFPCEVENRDNQ 914 >ref|XP_007046505.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma cacao] gi|508698766|gb|EOX90662.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma cacao] Length = 1016 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = -2 Query: 221 KKGIFASVIKDNKSAKSRNGHEAETQDCRKSIEELSTIFSIANFARDVETEEKK 60 KKGIF SV+K+ K +K ++ HE ET+D R+SIE+LSTIFS ANF +VE + + Sbjct: 826 KKGIFGSVLKEMKGSK-KHVHEVETEDTRESIEQLSTIFSTANFPCEVENRDNQ 878 >ref|XP_007046504.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508698765|gb|EOX90661.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 1026 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = -2 Query: 221 KKGIFASVIKDNKSAKSRNGHEAETQDCRKSIEELSTIFSIANFARDVETEEKK 60 KKGIF SV+K+ K +K ++ HE ET+D R+SIE+LSTIFS ANF +VE + + Sbjct: 862 KKGIFGSVLKEMKGSK-KHVHEVETEDTRESIEQLSTIFSTANFPCEVENRDNQ 914 >ref|XP_007046503.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508698764|gb|EOX90660.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 1052 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = -2 Query: 221 KKGIFASVIKDNKSAKSRNGHEAETQDCRKSIEELSTIFSIANFARDVETEEKK 60 KKGIF SV+K+ K +K ++ HE ET+D R+SIE+LSTIFS ANF +VE + + Sbjct: 862 KKGIFGSVLKEMKGSK-KHVHEVETEDTRESIEQLSTIFSTANFPCEVENRDNQ 914 >ref|XP_007204792.1| hypothetical protein PRUPE_ppa017381mg, partial [Prunus persica] gi|462400323|gb|EMJ05991.1| hypothetical protein PRUPE_ppa017381mg, partial [Prunus persica] Length = 1035 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = -2 Query: 221 KKGIFASVIKDNKSAKSRNGHEAETQDCRKSIEELSTIFSIANFARDVETEEKK 60 KKGIF+ VIKD +K++N E ET+D ++S EELSTIFS ANF D E +++ Sbjct: 842 KKGIFSYVIKDIVGSKAKNVPEIETEDTKESFEELSTIFSTANFTVDAENTDEQ 895 >ref|XP_004287725.1| PREDICTED: uncharacterized protein LOC101298930 [Fragaria vesca subsp. vesca] Length = 1034 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -2 Query: 221 KKGIFASVIKDNKSAKSRNGHEAETQDCRKSIEELSTIFSIANFARDVE 75 KKG+F+SV+KD +K +N E E +D ++SIEELSTIFS ANF D E Sbjct: 843 KKGMFSSVLKDIVGSKGKNVPEMEHEDTKESIEELSTIFSTANFQFDAE 891