BLASTX nr result
ID: Mentha27_contig00036514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00036514 (489 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631978.1| PREDICTED: uncharacterized protein LOC100855... 57 3e-06 >ref|XP_003631978.1| PREDICTED: uncharacterized protein LOC100855402 [Vitis vinifera] Length = 339 Score = 56.6 bits (135), Expect = 3e-06 Identities = 36/95 (37%), Positives = 45/95 (47%), Gaps = 10/95 (10%) Frame = +3 Query: 42 HEQVASQQGDDKYLHFAQTPDQVYSARSNFCMGDSGAFEPSMISAAQPPVNNTLGPH--- 212 +E S D +L Q PD+V S +G S P+M + Q VNN L PH Sbjct: 244 NEGHCSDMRDTHFLPSMQNPDKVLVQSSEVFLGKSEGCPPAMNFSNQVHVNNVLRPHAAP 303 Query: 213 -------YISNSYSFADKPENPLGTLQQDSGSVPV 296 Y+S YSFA PLGT+QQ +GSV V Sbjct: 304 VGTIKSKYLSKPYSFASNSGTPLGTIQQPNGSVSV 338