BLASTX nr result
ID: Mentha27_contig00034998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00034998 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22831.1| hypothetical protein MIMGU_mgv1a014867mg [Mimulus... 83 5e-14 >gb|EYU22831.1| hypothetical protein MIMGU_mgv1a014867mg [Mimulus guttatus] Length = 175 Score = 82.8 bits (203), Expect = 5e-14 Identities = 38/75 (50%), Positives = 56/75 (74%) Frame = -3 Query: 409 KLAFLKFQSSPVRLNFNEVLLCVESASFELFFPTACAMINVNERMQKISQCVLNMLLNVC 230 KLAF K+Q R+NFN+ LL +E A EL +PTAC ++N++ER Q++++C LNML +C Sbjct: 101 KLAFFKYQGHLARVNFNDSLLFLERACIELCYPTACTIVNLSERKQELAECFLNMLRYMC 160 Query: 229 SVKVLSLSLMTIEAV 185 +V+ LSLS+ TIE + Sbjct: 161 NVEFLSLSMKTIEVL 175