BLASTX nr result
ID: Mentha27_contig00034917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00034917 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45544.1| hypothetical protein MIMGU_mgv1a005993mg [Mimulus... 71 2e-10 >gb|EYU45544.1| hypothetical protein MIMGU_mgv1a005993mg [Mimulus guttatus] Length = 462 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/64 (54%), Positives = 44/64 (68%) Frame = -1 Query: 194 MATRLALKFARNCSLNRNVKPNNVLRRYFCSEASAGSAQAPPLPPPTRQKVPHFSKKGRL 15 MATR+ALKF R+CS+ R +K NN+ R FC+ G++ A PPP +KVP FSK GRL Sbjct: 1 MATRIALKFLRDCSVYRKIKSNNISRHSFCT----GASTAATPPPPISKKVPQFSKTGRL 56 Query: 14 FTAA 3 FT A Sbjct: 57 FTGA 60