BLASTX nr result
ID: Mentha27_contig00034486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00034486 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22342.1| hypothetical protein MIMGU_mgv1a016254mg [Mimulus... 57 3e-06 gb|EYU20020.1| hypothetical protein MIMGU_mgv1a016206mg [Mimulus... 55 8e-06 >gb|EYU22342.1| hypothetical protein MIMGU_mgv1a016254mg [Mimulus guttatus] Length = 129 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 98 LFVTRVNVTLGEKEERMMMTGSHIVADIFCVQ 3 LF VNVTLGEKEERMMMTGSH+VADIFCV+ Sbjct: 43 LFNKVVNVTLGEKEERMMMTGSHVVADIFCVK 74 >gb|EYU20020.1| hypothetical protein MIMGU_mgv1a016206mg [Mimulus guttatus] gi|604300179|gb|EYU20022.1| hypothetical protein MIMGU_mgv1a016206mg [Mimulus guttatus] Length = 92 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 101 LLFVTRVNVTLGEKEERMMMTGSHIVADIFCVQ 3 L+ RVNVTLG+KEERMMMTGSH VADIFCV+ Sbjct: 4 LISSRRVNVTLGDKEERMMMTGSHTVADIFCVK 36