BLASTX nr result
ID: Mentha27_contig00034452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00034452 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45757.1| hypothetical protein MIMGU_mgv1a025792mg [Mimulus... 56 5e-06 >gb|EYU45757.1| hypothetical protein MIMGU_mgv1a025792mg [Mimulus guttatus] Length = 279 Score = 56.2 bits (134), Expect = 5e-06 Identities = 33/61 (54%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Frame = -2 Query: 176 RICMTQSSDN---DAPTPAEQFTPLQAVFRRRLITXXXXXXXXXXXANFGGVTSFLFGFS 6 R TQSSD+ + P PA+QF LQ+VFRRRL+T ANF GVTSFL GFS Sbjct: 19 RTYATQSSDDGKQNLPPPADQFGSLQSVFRRRLLTGVSAASLLAVGANFVGVTSFLLGFS 78 Query: 5 P 3 P Sbjct: 79 P 79