BLASTX nr result
ID: Mentha27_contig00034429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00034429 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17408.1| hypothetical protein MIMGU_mgv1a004829mg [Mimulus... 94 3e-17 ref|XP_007019384.1| Auxin efflux carrier component isoform 2 [Th... 93 4e-17 ref|XP_007019383.1| Auxin efflux carrier component isoform 1 [Th... 93 4e-17 ref|XP_002278449.2| PREDICTED: probable auxin efflux carrier com... 89 5e-16 ref|NP_001234199.1| auxin efflux facilitator SlPIN6 [Solanum lyc... 86 4e-15 ref|XP_002887669.1| auxin transport protein [Arabidopsis lyrata ... 85 1e-14 ref|XP_006472919.1| PREDICTED: probable auxin efflux carrier com... 82 8e-14 ref|XP_006434374.1| hypothetical protein CICLE_v10000794mg [Citr... 82 8e-14 ref|XP_006356709.1| PREDICTED: probable auxin efflux carrier com... 82 1e-13 emb|CBI19962.3| unnamed protein product [Vitis vinifera] 81 1e-13 emb|CAN65343.1| hypothetical protein VITISV_025052 [Vitis vinifera] 81 1e-13 ref|XP_007199276.1| hypothetical protein PRUPE_ppa022797mg [Prun... 81 2e-13 dbj|BAO49657.1| putative auxin efflux carrier protein [Vigna ang... 79 8e-13 ref|XP_007161378.1| hypothetical protein PHAVU_001G0639001g, par... 79 8e-13 ref|XP_006390124.1| hypothetical protein EUTSA_v10018345mg [Eutr... 79 8e-13 ref|XP_002302196.2| hypothetical protein POPTR_0002s07310g [Popu... 77 2e-12 ref|XP_002526168.1| Auxin efflux carrier component, putative [Ri... 77 2e-12 ref|NP_001276195.1| uncharacterized protein LOC100818269 [Glycin... 76 5e-12 gb|AAD52696.1|AF087819_1 auxin transport protein [Arabidopsis th... 76 5e-12 ref|NP_177836.1| auxin efflux carrier protein PIN6 [Arabidopsis ... 76 5e-12 >gb|EYU17408.1| hypothetical protein MIMGU_mgv1a004829mg [Mimulus guttatus] Length = 508 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/61 (77%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTPNEFGFGLRPVSPR--LSGYASSDAYSLQPTPRPSNFNEF 9 +G TPR SNLSNAEIFSIGTP E+GFG RPVSP +GYASSDAYSLQPTPR S+FNE Sbjct: 216 VGPTPRGSNLSNAEIFSIGTPLEYGFGFRPVSPAGFSAGYASSDAYSLQPTPRASSFNEL 275 Query: 8 D 6 D Sbjct: 276 D 276 >ref|XP_007019384.1| Auxin efflux carrier component isoform 2 [Theobroma cacao] gi|508724712|gb|EOY16609.1| Auxin efflux carrier component isoform 2 [Theobroma cacao] Length = 540 Score = 92.8 bits (229), Expect = 4e-17 Identities = 48/70 (68%), Positives = 51/70 (72%), Gaps = 12/70 (17%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPN------------EFGFGLRPVSPRLSGYASSDAYSLQPTP 33 LTPRASNLSNAEIFS+ TP + GFG R VSPRLSGYASSDAYSLQPTP Sbjct: 215 LTPRASNLSNAEIFSVNTPGGPNNNEIVFCNGDLGFGYRAVSPRLSGYASSDAYSLQPTP 274 Query: 32 RPSNFNEFDI 3 R SNFNE D+ Sbjct: 275 RASNFNEMDV 284 >ref|XP_007019383.1| Auxin efflux carrier component isoform 1 [Theobroma cacao] gi|508724711|gb|EOY16608.1| Auxin efflux carrier component isoform 1 [Theobroma cacao] Length = 547 Score = 92.8 bits (229), Expect = 4e-17 Identities = 48/70 (68%), Positives = 51/70 (72%), Gaps = 12/70 (17%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPN------------EFGFGLRPVSPRLSGYASSDAYSLQPTP 33 LTPRASNLSNAEIFS+ TP + GFG R VSPRLSGYASSDAYSLQPTP Sbjct: 225 LTPRASNLSNAEIFSVNTPGGPNNNEIVFCNGDLGFGYRAVSPRLSGYASSDAYSLQPTP 284 Query: 32 RPSNFNEFDI 3 R SNFNE D+ Sbjct: 285 RASNFNEMDV 294 >ref|XP_002278449.2| PREDICTED: probable auxin efflux carrier component 6-like [Vitis vinifera] Length = 532 Score = 89.4 bits (220), Expect = 5e-16 Identities = 47/76 (61%), Positives = 50/76 (65%), Gaps = 17/76 (22%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTP-----------------NEFGFGLRPVSPRLSGYASSDA 54 MG+TPRASNLS AEIFS+ TP + GFG R SPRLSGYASSDA Sbjct: 222 MGITPRASNLSGAEIFSVNTPAPLHEYHNGNADIAFGNGDLGFGYRSASPRLSGYASSDA 281 Query: 53 YSLQPTPRPSNFNEFD 6 YSLQPTPR SNFNE D Sbjct: 282 YSLQPTPRASNFNELD 297 >ref|NP_001234199.1| auxin efflux facilitator SlPIN6 [Solanum lycopersicum] gi|327187149|gb|ADR30414.2| auxin efflux facilitator SlPIN6 [Solanum lycopersicum] Length = 538 Score = 86.3 bits (212), Expect = 4e-15 Identities = 46/71 (64%), Positives = 51/71 (71%), Gaps = 11/71 (15%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTP----------NEFGFGLRPVSPRLSG-YASSDAYSLQPT 36 +G+TPRASNLSNAEIFS+ TP + G G R SPRLSG YASSDAYSLQPT Sbjct: 221 IGITPRASNLSNAEIFSVHTPLHNGDIPFGHGDLGVGFRAASPRLSGGYASSDAYSLQPT 280 Query: 35 PRPSNFNEFDI 3 PR SNFNE D+ Sbjct: 281 PRASNFNELDV 291 >ref|XP_002887669.1| auxin transport protein [Arabidopsis lyrata subsp. lyrata] gi|297333510|gb|EFH63928.1| auxin transport protein [Arabidopsis lyrata subsp. lyrata] Length = 551 Score = 84.7 bits (208), Expect = 1e-14 Identities = 50/73 (68%), Positives = 52/73 (71%), Gaps = 15/73 (20%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPNEF----------GFGL-RP---VSPR-LSGYASSDAYSLQ 42 LTPRASNLSNAEIFS+ TPN F GFG RP SPR LSGYASSDAYSLQ Sbjct: 225 LTPRASNLSNAEIFSVNTPNRFFNGGGGSDLGGFGFTRPGFGASPRRLSGYASSDAYSLQ 284 Query: 41 PTPRPSNFNEFDI 3 PTPR SNFNE D+ Sbjct: 285 PTPRASNFNELDV 297 >ref|XP_006472919.1| PREDICTED: probable auxin efflux carrier component 6-like [Citrus sinensis] Length = 540 Score = 82.0 bits (201), Expect = 8e-14 Identities = 46/68 (67%), Positives = 46/68 (67%), Gaps = 11/68 (16%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTP-----------NEFGFGLRPVSPRLSGYASSDAYSLQPTPR 30 LTPRASNLSNAEIFSI TP NE F SPRLS YASSDAYSLQPTPR Sbjct: 224 LTPRASNLSNAEIFSINTPAPLHDYHYNSNNEIVFWGSATSPRLSNYASSDAYSLQPTPR 283 Query: 29 PSNFNEFD 6 SNFNE D Sbjct: 284 ASNFNEMD 291 >ref|XP_006434374.1| hypothetical protein CICLE_v10000794mg [Citrus clementina] gi|557536496|gb|ESR47614.1| hypothetical protein CICLE_v10000794mg [Citrus clementina] Length = 540 Score = 82.0 bits (201), Expect = 8e-14 Identities = 46/68 (67%), Positives = 46/68 (67%), Gaps = 11/68 (16%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTP-----------NEFGFGLRPVSPRLSGYASSDAYSLQPTPR 30 LTPRASNLSNAEIFSI TP NE F SPRLS YASSDAYSLQPTPR Sbjct: 224 LTPRASNLSNAEIFSINTPAPLHDYHYNSNNEIVFWGSATSPRLSNYASSDAYSLQPTPR 283 Query: 29 PSNFNEFD 6 SNFNE D Sbjct: 284 ASNFNEMD 291 >ref|XP_006356709.1| PREDICTED: probable auxin efflux carrier component 6-like [Solanum tuberosum] Length = 541 Score = 81.6 bits (200), Expect = 1e-13 Identities = 45/70 (64%), Positives = 49/70 (70%), Gaps = 11/70 (15%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTP----------NEFGFGLRPVSPRLSG-YASSDAYSLQPT 36 +G+TPRASNLSNAEIFS+ TP + G G R S RLSG YASSDAYSLQPT Sbjct: 221 IGITPRASNLSNAEIFSVHTPLHNGDIPFGHGDLGVGFRAASTRLSGGYASSDAYSLQPT 280 Query: 35 PRPSNFNEFD 6 PR SNFNE D Sbjct: 281 PRGSNFNELD 290 >emb|CBI19962.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 81.3 bits (199), Expect = 1e-13 Identities = 42/59 (71%), Positives = 44/59 (74%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTPNEFGFGLRPVSPRLSGYASSDAYSLQPTPRPSNFNEFD 6 MG+TPRASNLS AEIFS+ TP PRLSGYASSDAYSLQPTPR SNFNE D Sbjct: 222 MGITPRASNLSGAEIFSVNTPAPLH------DPRLSGYASSDAYSLQPTPRASNFNELD 274 >emb|CAN65343.1| hypothetical protein VITISV_025052 [Vitis vinifera] Length = 512 Score = 81.3 bits (199), Expect = 1e-13 Identities = 42/59 (71%), Positives = 44/59 (74%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTPNEFGFGLRPVSPRLSGYASSDAYSLQPTPRPSNFNEFD 6 MG+TPRASNLS AEIFS+ TP PRLSGYASSDAYSLQPTPR SNFNE D Sbjct: 222 MGITPRASNLSGAEIFSVNTPAPLH------DPRLSGYASSDAYSLQPTPRASNFNELD 274 >ref|XP_007199276.1| hypothetical protein PRUPE_ppa022797mg [Prunus persica] gi|462394676|gb|EMJ00475.1| hypothetical protein PRUPE_ppa022797mg [Prunus persica] Length = 550 Score = 80.9 bits (198), Expect = 2e-13 Identities = 45/71 (63%), Positives = 48/71 (67%), Gaps = 12/71 (16%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTPN-----------EFGFGLRPVSPRLS-GYASSDAYSLQP 39 MGLTPR SNLSNAEIFSI TP+ + FG R SP+ S GYASSDAYSLQP Sbjct: 224 MGLTPRPSNLSNAEIFSINTPHHANHDFTLGHGDVAFGYRSASPQFSTGYASSDAYSLQP 283 Query: 38 TPRPSNFNEFD 6 TPR S FNE D Sbjct: 284 TPRASTFNEMD 294 >dbj|BAO49657.1| putative auxin efflux carrier protein [Vigna angularis] Length = 527 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/59 (71%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPNEFGFGLRPV--SPRLSGYASSDAYSLQPTPRPSNFNEFD 6 LTPR SNLSNA+IFSI TP G P SP LSGYASSDAYSLQPTPR SNFNE + Sbjct: 228 LTPRPSNLSNADIFSINTPLHLHDGDPPAGASPHLSGYASSDAYSLQPTPRASNFNEME 286 >ref|XP_007161378.1| hypothetical protein PHAVU_001G0639001g, partial [Phaseolus vulgaris] gi|561034842|gb|ESW33372.1| hypothetical protein PHAVU_001G0639001g, partial [Phaseolus vulgaris] Length = 335 Score = 78.6 bits (192), Expect = 8e-13 Identities = 42/59 (71%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPNEFGFGLRPV--SPRLSGYASSDAYSLQPTPRPSNFNEFD 6 LTPR SNLSNA+IFSI TP G P SP LSGYASSDAYSLQPTPR SNFNE + Sbjct: 228 LTPRPSNLSNADIFSINTPLHLHDGDHPAGASPYLSGYASSDAYSLQPTPRASNFNEME 286 >ref|XP_006390124.1| hypothetical protein EUTSA_v10018345mg [Eutrema salsugineum] gi|557086558|gb|ESQ27410.1| hypothetical protein EUTSA_v10018345mg [Eutrema salsugineum] Length = 568 Score = 78.6 bits (192), Expect = 8e-13 Identities = 51/89 (57%), Positives = 53/89 (59%), Gaps = 31/89 (34%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPNEF--------------------------GFGL-RP---VS 87 LTPRASNLSNAEIFS+ TPN F GFG RP VS Sbjct: 225 LTPRASNLSNAEIFSVNTPNCFFNGGGSGTLQFYNGNNEIMFCNGDLGGFGFTRPGCGVS 284 Query: 86 PR-LSGYASSDAYSLQPTPRPSNFNEFDI 3 PR LSGYASSDAYSLQPTPR SNFNE D+ Sbjct: 285 PRRLSGYASSDAYSLQPTPRASNFNELDV 313 >ref|XP_002302196.2| hypothetical protein POPTR_0002s07310g [Populus trichocarpa] gi|550344469|gb|EEE81469.2| hypothetical protein POPTR_0002s07310g [Populus trichocarpa] Length = 369 Score = 77.4 bits (189), Expect = 2e-12 Identities = 45/85 (52%), Positives = 50/85 (58%), Gaps = 27/85 (31%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTP------------------NE---------FGFGLRPVSPRL 78 LTPR SNLSNAE+FS+ TP NE FG+ SPRL Sbjct: 224 LTPRPSNLSNAEVFSVSTPAPLQEYHGYNGRFSHGPNNEIMLCNGDLGFGYHRSGTSPRL 283 Query: 77 SGYASSDAYSLQPTPRPSNFNEFDI 3 SGYASSDAYSLQPTPR SNFNE+D+ Sbjct: 284 SGYASSDAYSLQPTPRTSNFNEWDL 308 >ref|XP_002526168.1| Auxin efflux carrier component, putative [Ricinus communis] gi|223534545|gb|EEF36244.1| Auxin efflux carrier component, putative [Ricinus communis] Length = 544 Score = 77.0 bits (188), Expect = 2e-12 Identities = 47/95 (49%), Positives = 50/95 (52%), Gaps = 35/95 (36%) Frame = -1 Query: 182 MGLTPRASNLSNAEIFSIGTPNEF----------------------------------GF 105 + LTPR SNLSNAEIFS+ TP F GF Sbjct: 222 INLTPRPSNLSNAEIFSVNTPAPFHDYNIHNPNNIYNLYNNNHGGTNNNEIIICNGDLGF 281 Query: 104 GLRP-VSPRLSGYASSDAYSLQPTPRPSNFNEFDI 3 G R SPRLSGYASSDAYSLQPTPR SNFNE D+ Sbjct: 282 GYRSGTSPRLSGYASSDAYSLQPTPRASNFNEMDV 316 >ref|NP_001276195.1| uncharacterized protein LOC100818269 [Glycine max] gi|481044560|gb|AGJ95062.1| PIN6a [Glycine max] Length = 478 Score = 75.9 bits (185), Expect = 5e-12 Identities = 42/61 (68%), Positives = 46/61 (75%), Gaps = 4/61 (6%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTP---NEFGFGLRP-VSPRLSGYASSDAYSLQPTPRPSNFNEF 9 +TPR SNLSNA+IFSI TP +E G L SP LSGYASSDAYSLQPTPR SNFNE Sbjct: 229 VTPRQSNLSNADIFSINTPLHLHEGGGNLAAGASPHLSGYASSDAYSLQPTPRASNFNEM 288 Query: 8 D 6 + Sbjct: 289 E 289 >gb|AAD52696.1|AF087819_1 auxin transport protein [Arabidopsis thaliana] Length = 570 Score = 75.9 bits (185), Expect = 5e-12 Identities = 47/91 (51%), Positives = 49/91 (53%), Gaps = 33/91 (36%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPNE------------------------------FGF---GLR 96 LTPRASNLSNAEIFS+ TPN FGF GL Sbjct: 225 LTPRASNLSNAEIFSVNTPNNRFFHGGGGSGTLQFYNGSNEIMFCNGDLGGFGFTRPGLG 284 Query: 95 PVSPRLSGYASSDAYSLQPTPRPSNFNEFDI 3 RLSGYASSDAYSLQPTPR SNFNE D+ Sbjct: 285 ASPRRLSGYASSDAYSLQPTPRASNFNELDV 315 >ref|NP_177836.1| auxin efflux carrier protein PIN6 [Arabidopsis thaliana] gi|42558888|sp|Q9SQH6.2|PIN6_ARATH RecName: Full=Probable auxin efflux carrier component 6; Short=AtPIN6 gi|332197815|gb|AEE35936.1| auxin efflux carrier protein PIN6 [Arabidopsis thaliana] Length = 570 Score = 75.9 bits (185), Expect = 5e-12 Identities = 47/91 (51%), Positives = 49/91 (53%), Gaps = 33/91 (36%) Frame = -1 Query: 176 LTPRASNLSNAEIFSIGTPNE------------------------------FGF---GLR 96 LTPRASNLSNAEIFS+ TPN FGF GL Sbjct: 225 LTPRASNLSNAEIFSVNTPNNRFFHGGGGSGTLQFYNGSNEIMFCNGDLGGFGFTRPGLG 284 Query: 95 PVSPRLSGYASSDAYSLQPTPRPSNFNEFDI 3 RLSGYASSDAYSLQPTPR SNFNE D+ Sbjct: 285 ASPRRLSGYASSDAYSLQPTPRASNFNELDV 315