BLASTX nr result
ID: Mentha27_contig00033706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00033706 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41995.1| hypothetical protein MIMGU_mgv1a012823mg [Mimulus... 57 3e-06 >gb|EYU41995.1| hypothetical protein MIMGU_mgv1a012823mg [Mimulus guttatus] Length = 239 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 6/70 (8%) Frame = -1 Query: 394 YVRKRRRFSSWGSSFDGRAAXGNGVRS------SRLCFAIXXXXXXXXXXXSALVVKRAL 233 YVRKRRRFSSWGSSFD RA+ + VR+ + CF I S +VK+A Sbjct: 170 YVRKRRRFSSWGSSFDDRASAISSVRNDDVSPPANSCFGI--GKDKSDGGYSVFIVKKAF 227 Query: 232 LSIVGRGSAA 203 LSIVGRG A+ Sbjct: 228 LSIVGRGRAS 237