BLASTX nr result
ID: Mentha27_contig00033553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00033553 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37112.1| hypothetical protein MIMGU_mgv1a010916mg [Mimulus... 73 4e-11 >gb|EYU37112.1| hypothetical protein MIMGU_mgv1a010916mg [Mimulus guttatus] Length = 297 Score = 73.2 bits (178), Expect = 4e-11 Identities = 46/80 (57%), Positives = 49/80 (61%), Gaps = 5/80 (6%) Frame = +2 Query: 2 APFP-PIPCRRP----FLAPYCQLSDHQTAPQLAIPPKPVTINRSLLSVSATCSEAELLA 166 A FP P RRP L CQL+D + P A P K I+R LLSVS T SEAEL A Sbjct: 37 AAFPVKFPRRRPPALRSLRVNCQLADQRVTPPAATPAKTSRISRPLLSVSETTSEAELWA 96 Query: 167 AVRLRVRTFYDFDERTFNIE 226 AV LRVRTFYDF E TF IE Sbjct: 97 AVCLRVRTFYDFKEPTFGIE 116