BLASTX nr result
ID: Mentha27_contig00033452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00033452 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21152.1| hypothetical protein MIMGU_mgv1a026124mg, partial... 64 2e-08 ref|XP_004228391.1| PREDICTED: protein kinase 2B, chloroplastic-... 61 2e-07 ref|XP_006363926.1| PREDICTED: protein kinase 2B, chloroplastic-... 60 2e-07 gb|EYU17816.1| hypothetical protein MIMGU_mgv1a018872mg, partial... 59 7e-07 ref|XP_006363247.1| PREDICTED: protein kinase 2B, chloroplastic-... 58 1e-06 ref|XP_004238776.1| PREDICTED: protein kinase 2B, chloroplastic-... 58 1e-06 gb|AAT39953.2| Protein kinase APK1B, chloroplast precursor, puta... 58 1e-06 gb|AAT40481.1| putative protein kinase [Solanum demissum] 58 1e-06 >gb|EYU21152.1| hypothetical protein MIMGU_mgv1a026124mg, partial [Mimulus guttatus] Length = 313 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/45 (60%), Positives = 39/45 (86%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQL 137 MD +++GQ+PH EAY++A +A +CLS+ P +RPRMAEV+VAL+QL Sbjct: 269 MDPKIEGQFPHKEAYTVATIALQCLSQMPEQRPRMAEVLVALEQL 313 >ref|XP_004228391.1| PREDICTED: protein kinase 2B, chloroplastic-like [Solanum lycopersicum] Length = 419 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/62 (48%), Positives = 41/62 (66%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQLE*ESMVFYSKPLGMN 182 MDT+L+GQYP AY+ A LA++CLS P RPRM+EV+ AL+QL+ P G+N Sbjct: 324 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPRMSEVLAALEQLQ--------APKGVN 375 Query: 183 SV 188 + Sbjct: 376 KI 377 >ref|XP_006363926.1| PREDICTED: protein kinase 2B, chloroplastic-like [Solanum tuberosum] Length = 419 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQLE 140 MDT+L+GQYP AY+ A LA++CLS P RPRM+EV+ AL+QL+ Sbjct: 324 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPRMSEVLAALEQLQ 369 >gb|EYU17816.1| hypothetical protein MIMGU_mgv1a018872mg, partial [Mimulus guttatus] Length = 318 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQL 137 MD +L+G++PH EAY+ A +A +CLS+ P +RPRMAEV+V +Q+ Sbjct: 272 MDPKLEGRFPHKEAYTAATIALQCLSQMPEQRPRMAEVLVVFEQM 316 >ref|XP_006363247.1| PREDICTED: protein kinase 2B, chloroplastic-like [Solanum tuberosum] Length = 420 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQLE 140 MDT+L+GQYP AY+ A LA++CLS P RP+M+EV+ AL++L+ Sbjct: 324 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQ 369 >ref|XP_004238776.1| PREDICTED: protein kinase 2B, chloroplastic-like [Solanum lycopersicum] Length = 420 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQLE 140 MDT+L+GQYP AY+ A LA++CLS P RP+M+EV+ AL++L+ Sbjct: 324 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQ 369 >gb|AAT39953.2| Protein kinase APK1B, chloroplast precursor, putative [Solanum demissum] Length = 401 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQLE 140 MDT+L+GQYP AY+ A LA++CLS P RP+M+EV+ AL++L+ Sbjct: 305 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQ 350 >gb|AAT40481.1| putative protein kinase [Solanum demissum] Length = 420 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = +3 Query: 3 MDTRLQGQYPHNEAYSLAKLAYRCLSKTPVERPRMAEVVVALQQLE 140 MDT+L+GQYP AY+ A LA++CLS P RP+M+EV+ AL++L+ Sbjct: 324 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQ 369