BLASTX nr result
ID: Mentha27_contig00033185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00033185 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28142.1| hypothetical protein MIMGU_mgv1a014598mg [Mimulus... 76 4e-12 ref|XP_002522293.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 >gb|EYU28142.1| hypothetical protein MIMGU_mgv1a014598mg [Mimulus guttatus] Length = 184 Score = 76.3 bits (186), Expect = 4e-12 Identities = 47/98 (47%), Positives = 54/98 (55%), Gaps = 4/98 (4%) Frame = +3 Query: 90 YGALFSLSQSLISRVPALRTARGDVEGXXXXXXXXXXXXXXXXV----YGLTVLLDYMKN 257 Y LFSLS SL SRV LR+ARGD EG V + L V DY+KN Sbjct: 30 YHTLFSLSHSLTSRVATLRSARGDYEGAARARALARNLERGLGVGFYKFALNVGWDYVKN 89 Query: 258 YDRKDATSFRDLGGVVSDLNELLGVLRGLNQARLDVER 371 Y +D SF LGG++SDLNELLG L LN+ D ER Sbjct: 90 YAWRDTMSFGTLGGLLSDLNELLGSLSELNRINSDAER 127 >ref|XP_002522293.1| conserved hypothetical protein [Ricinus communis] gi|223538546|gb|EEF40151.1| conserved hypothetical protein [Ricinus communis] Length = 228 Score = 65.5 bits (158), Expect = 7e-09 Identities = 40/95 (42%), Positives = 52/95 (54%) Frame = +3 Query: 87 KYGALFSLSQSLISRVPALRTARGDVEGXXXXXXXXXXXXXXXXVYGLTVLLDYMKNYDR 266 +Y + SLS SL +RV LR ARGD+ G +V DY+KNY Sbjct: 49 QYKTIISLSHSLFTRVSNLRAARGDIAGASRAKGIADRLEKGFWGLAGSVGFDYVKNYSW 108 Query: 267 KDATSFRDLGGVVSDLNELLGVLRGLNQARLDVER 371 +D ++R+L GVVSDLNEL VL L QA D++R Sbjct: 109 RDL-NYRELYGVVSDLNELASVLSELTQAESDMQR 142