BLASTX nr result
ID: Mentha27_contig00033118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00033118 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41819.1| hypothetical protein MIMGU_mgv1a009026mg [Mimulus... 64 3e-08 >gb|EYU41819.1| hypothetical protein MIMGU_mgv1a009026mg [Mimulus guttatus] Length = 355 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/56 (57%), Positives = 38/56 (67%) Frame = +3 Query: 246 MAAFSSPRXXXXXXXXXXXXKVMDADPNLTFYYKNFGKDSSFESQLVLFGDAKVAK 413 MA FSS R KV++ +PN+TF +KNFGKDS+F SQL LFGDAKVAK Sbjct: 1 MAVFSSSRYFLAFLLLNIFLKVINGEPNITFSFKNFGKDSNFGSQLSLFGDAKVAK 56