BLASTX nr result
ID: Mentha27_contig00031775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00031775 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73839.1| hypothetical protein M569_00902, partial [Genlise... 58 2e-06 >gb|EPS73839.1| hypothetical protein M569_00902, partial [Genlisea aurea] Length = 1082 Score = 57.8 bits (138), Expect = 2e-06 Identities = 35/80 (43%), Positives = 38/80 (47%), Gaps = 21/80 (26%) Frame = +3 Query: 186 GDGGFELSRYLFLGSLLFSREGGG-------------IYKCYKFGI--------QVPXXX 302 GDGGFELSRYLFLGSLL SREGGG + G+ +VP Sbjct: 6 GDGGFELSRYLFLGSLLLSREGGGMDLSKVGEKIVSSVRSARSLGLLPSLSDRPEVPERA 65 Query: 303 XXXXXXXXXXXGLPPHQRHN 362 GLPPHQRHN Sbjct: 66 AAAAALARVLAGLPPHQRHN 85