BLASTX nr result
ID: Mentha27_contig00031728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00031728 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOO01265.1| putative ubiquitin-40s ribosomal protein s31 fusi... 68 1e-09 ref|XP_391117.1| hypothetical protein FG10941.1 [Fusarium gramin... 67 2e-09 emb|CCT71659.1| probable ubiquitin/ribosomal protein S27a fusion... 67 2e-09 ref|XP_003047931.1| ubiquitin-40S ribosomal protein S31 fusion p... 67 2e-09 ref|XP_003713173.1| ubiquitin-40S ribosomal protein S27a [Magnap... 67 2e-09 gb|AAC13690.1| ubiquitin fusion protein [Magnaporthe grisea] 67 2e-09 ref|XP_007603155.1| ubiquitin-40S ribosomal protein S27a, partia... 67 3e-09 gb|EQB50539.1| hypothetical protein CGLO_10017 [Colletotrichum g... 67 3e-09 emb|CCF45248.1| ubiquitin-40S ribosomal protein S27a [Colletotri... 67 3e-09 gb|EFQ30415.1| ubiquitin family protein [Colletotrichum graminic... 67 3e-09 gb|EMR65118.1| putative ubiquitin-40s ribosomal protein s31 fusi... 67 3e-09 ref|XP_003005604.1| ubiquitin-40S ribosomal protein S31 fusion p... 66 4e-09 gb|ETS73867.1| Ubiquitin-40S ribosomal protein S27a [Pestalotiop... 65 7e-09 gb|ERS98830.1| ubiquitin-40S ribosomal protein S27a [Sporothrix ... 65 7e-09 gb|EFX03368.1| ubiquitin [Grosmannia clavigera kw1407] 65 7e-09 gb|EHK44152.1| hypothetical protein TRIATDRAFT_300462 [Trichoder... 65 1e-08 ref|XP_006665710.1| ubiquitin [Cordyceps militaris CM01] gi|3463... 65 1e-08 ref|XP_006968883.1| ubiquitin/small ribosomal subunit protein 31... 65 1e-08 emb|CAA33390.1| UBI 3 fusion protein (149 AA) [Neurospora crassa] 64 2e-08 gb|AAA56880.1| ubiquitin/S27a fusion protein [Neurospora crassa]... 64 2e-08 >gb|EOO01265.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Togninia minima UCRPA7] Length = 154 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQKN 95 +TCGAGVFMAAMQDRQYCGRCHLTYVFD+K+ Sbjct: 124 ETCGAGVFMAAMQDRQYCGRCHLTYVFDKKD 154 >ref|XP_391117.1| hypothetical protein FG10941.1 [Fusarium graminearum PH-1] gi|342882263|gb|EGU82991.1| hypothetical protein FOXB_06544 [Fusarium oxysporum Fo5176] gi|408394571|gb|EKJ73774.1| hypothetical protein FPSE_06055 [Fusarium pseudograminearum CS3096] gi|475676324|gb|EMT73358.1| Ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. cubense race 4] gi|477514801|gb|ENH67166.1| Ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. cubense race 1] gi|558867728|gb|ESU17811.1| hypothetical protein FGSG_10941 [Fusarium graminearum PH-1] gi|587663737|gb|EWY86078.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum FOSC 3-a] gi|587663738|gb|EWY86079.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum FOSC 3-a] gi|587663739|gb|EWY86080.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum FOSC 3-a] gi|587685095|gb|EWZ31700.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum Fo47] gi|587685096|gb|EWZ31701.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum Fo47] gi|587685097|gb|EWZ31702.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum Fo47] gi|587722947|gb|EWZ94284.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. lycopersici MN25] gi|587722948|gb|EWZ94285.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. lycopersici MN25] gi|587722949|gb|EWZ94286.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. lycopersici MN25] gi|587741863|gb|EXA39579.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. pisi HDV247] gi|587741864|gb|EXA39580.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. pisi HDV247] gi|587741865|gb|EXA39581.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. pisi HDV247] gi|590036417|gb|EXK38275.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. melonis 26406] gi|590036418|gb|EXK38276.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. melonis 26406] gi|590036419|gb|EXK38277.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. melonis 26406] gi|590065785|gb|EXK93309.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. raphani 54005] gi|590065786|gb|EXK93310.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. raphani 54005] gi|590065787|gb|EXK93311.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. raphani 54005] gi|591407839|gb|EXL42976.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591407840|gb|EXL42977.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591407841|gb|EXL42978.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591447516|gb|EXL79955.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591447517|gb|EXL79956.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591447518|gb|EXL79957.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591469301|gb|EXM00628.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591469302|gb|EXM00629.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591469303|gb|EXM00630.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591497373|gb|EXM26855.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591497374|gb|EXM26856.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. vasinfectum 25433] gi|591497375|gb|EXM26857.1| ubiquitin-40S ribosomal protein S27a [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596549269|gb|EYB28932.1| hypothetical protein FG05_10941 [Fusarium graminearum] Length = 154 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAMQDRQYCGRCHLTYVFD++ Sbjct: 125 DTCGAGVFMAAMQDRQYCGRCHLTYVFDKQ 154 >emb|CCT71659.1| probable ubiquitin/ribosomal protein S27a fusion protein [Fusarium fujikuroi IMI 58289] gi|584143850|gb|EWG53148.1| ubiquitin-40S ribosomal protein S27a [Fusarium verticillioides 7600] gi|584143851|gb|EWG53149.1| ubiquitin-40S ribosomal protein S27a [Fusarium verticillioides 7600] Length = 154 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAMQDRQYCGRCHLTYVFD++ Sbjct: 125 DTCGAGVFMAAMQDRQYCGRCHLTYVFDKQ 154 >ref|XP_003047931.1| ubiquitin-40S ribosomal protein S31 fusion protein [Nectria haematococca mpVI 77-13-4] gi|256728863|gb|EEU42218.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 153 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAMQDRQYCGRCHLTYVFD++ Sbjct: 124 DTCGAGVFMAAMQDRQYCGRCHLTYVFDKQ 153 >ref|XP_003713173.1| ubiquitin-40S ribosomal protein S27a [Magnaporthe oryzae 70-15] gi|291195749|gb|ADD84591.1| poly-ubiquitin [Magnaporthe oryzae] gi|351645505|gb|EHA53366.1| ubiquitin-40S ribosomal protein S27a [Magnaporthe oryzae 70-15] gi|402087642|gb|EJT82540.1| ubiquitin-40S ribosomal protein S27a [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440466447|gb|ELQ35714.1| ubiquitin [Magnaporthe oryzae Y34] gi|440488149|gb|ELQ67889.1| ubiquitin [Magnaporthe oryzae P131] Length = 154 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQKN 95 +TCGAG+FMAAMQDRQYCGRCHLTYVFD+K+ Sbjct: 124 ETCGAGIFMAAMQDRQYCGRCHLTYVFDKKD 154 >gb|AAC13690.1| ubiquitin fusion protein [Magnaporthe grisea] Length = 154 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQKN 95 +TCGAG+FMAAMQDRQYCGRCHLTYVFD+K+ Sbjct: 124 ETCGAGIFMAAMQDRQYCGRCHLTYVFDKKD 154 >ref|XP_007603155.1| ubiquitin-40S ribosomal protein S27a, partial [Colletotrichum fioriniae PJ7] gi|588890553|gb|EXF73260.1| ubiquitin-40S ribosomal protein S27a, partial [Colletotrichum fioriniae PJ7] Length = 122 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAM DRQYCGRCHLTYVFD+K Sbjct: 92 DTCGAGVFMAAMNDRQYCGRCHLTYVFDKK 121 >gb|EQB50539.1| hypothetical protein CGLO_10017 [Colletotrichum gloeosporioides Cg-14] Length = 154 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAM DRQYCGRCHLTYVFD+K Sbjct: 124 DTCGAGVFMAAMNDRQYCGRCHLTYVFDKK 153 >emb|CCF45248.1| ubiquitin-40S ribosomal protein S27a [Colletotrichum higginsianum] Length = 155 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAM DRQYCGRCHLTYVFD+K Sbjct: 125 DTCGAGVFMAAMNDRQYCGRCHLTYVFDKK 154 >gb|EFQ30415.1| ubiquitin family protein [Colletotrichum graminicola M1.001] gi|477531585|gb|ENH83292.1| ubiquitin [Colletotrichum orbiculare MAFF 240422] Length = 154 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAM DRQYCGRCHLTYVFD+K Sbjct: 124 DTCGAGVFMAAMNDRQYCGRCHLTYVFDKK 153 >gb|EMR65118.1| putative ubiquitin-40s ribosomal protein s31 fusion protein [Eutypa lata UCREL1] Length = 153 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQ 89 DTCGAG+FMAAMQDRQYCGRCHLTYVFD+ Sbjct: 124 DTCGAGIFMAAMQDRQYCGRCHLTYVFDK 152 >ref|XP_003005604.1| ubiquitin-40S ribosomal protein S31 fusion protein [Verticillium alfalfae VaMs.102] gi|261355020|gb|EEY17448.1| 40S ribosomal protein S27a [Verticillium alfalfae VaMs.102] gi|346978058|gb|EGY21510.1| 40S ribosomal protein S27a [Verticillium dahliae VdLs.17] Length = 153 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 9 CGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 CGAGVFMAAMQDRQYCGRCHLTYVFDQK Sbjct: 126 CGAGVFMAAMQDRQYCGRCHLTYVFDQK 153 >gb|ETS73867.1| Ubiquitin-40S ribosomal protein S27a [Pestalotiopsis fici W106-1] Length = 153 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQ 89 +TCGAGVFMAAMQDRQYCGRCHLTYVFD+ Sbjct: 124 ETCGAGVFMAAMQDRQYCGRCHLTYVFDK 152 >gb|ERS98830.1| ubiquitin-40S ribosomal protein S27a [Sporothrix schenckii ATCC 58251] Length = 154 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQKN 95 +TCGAGVFMAAMQDRQYCGRCHLTYVF + N Sbjct: 124 ETCGAGVFMAAMQDRQYCGRCHLTYVFGENN 154 >gb|EFX03368.1| ubiquitin [Grosmannia clavigera kw1407] Length = 97 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQKN 95 +TCGAGVFMAAMQDRQYCGRCHLTYVF +K+ Sbjct: 67 ETCGAGVFMAAMQDRQYCGRCHLTYVFGEKD 97 >gb|EHK44152.1| hypothetical protein TRIATDRAFT_300462 [Trichoderma atroviride IMI 206040] Length = 153 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAM DRQYCGRCHLTYVFD++ Sbjct: 124 DTCGAGVFMAAMPDRQYCGRCHLTYVFDKQ 153 >ref|XP_006665710.1| ubiquitin [Cordyceps militaris CM01] gi|346326237|gb|EGX95833.1| ubiquitin [Cordyceps militaris CM01] gi|400593850|gb|EJP61747.1| ubiquitin family protein [Beauveria bassiana ARSEF 2860] Length = 153 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAM DRQYCGRCHLTYVFD++ Sbjct: 124 DTCGAGVFMAAMADRQYCGRCHLTYVFDKQ 153 >ref|XP_006968883.1| ubiquitin/small ribosomal subunit protein 31 fusion protein [Trichoderma reesei QM6a] gi|340514956|gb|EGR45214.1| ubiquitin/small ribosomal subunit protein 31 fusion protein [Trichoderma reesei QM6a] gi|358386134|gb|EHK23730.1| hypothetical protein TRIVIDRAFT_179162 [Trichoderma virens Gv29-8] gi|572274892|gb|ETR98378.1| ubiquitin-domain-containing protein [Trichoderma reesei RUT C-30] Length = 153 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQK 92 DTCGAGVFMAAM DRQYCGRCHLTYVFD++ Sbjct: 124 DTCGAGVFMAAMPDRQYCGRCHLTYVFDKQ 153 >emb|CAA33390.1| UBI 3 fusion protein (149 AA) [Neurospora crassa] Length = 149 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQKN 95 +TCGAGVFMAAMQDRQYCGRCHLTYVF++ + Sbjct: 119 ETCGAGVFMAAMQDRQYCGRCHLTYVFEKSS 149 >gb|AAA56880.1| ubiquitin/S27a fusion protein [Neurospora crassa] gi|402244|gb|AAA03351.1| ubiquitin/ribosomal protein S27a fusion protein [Neurospora crassa] Length = 154 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 DTCGAGVFMAAMQDRQYCGRCHLTYVFDQKN 95 +TCGAGVFMAAMQDRQYCGRCHLTYVF++ + Sbjct: 124 ETCGAGVFMAAMQDRQYCGRCHLTYVFEKSS 154