BLASTX nr result
ID: Mentha27_contig00031644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00031644 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23568.1| hypothetical protein MIMGU_mgv1a020952mg [Mimulus... 64 3e-08 >gb|EYU23568.1| hypothetical protein MIMGU_mgv1a020952mg [Mimulus guttatus] Length = 904 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/77 (41%), Positives = 51/77 (66%), Gaps = 1/77 (1%) Frame = +3 Query: 3 EELLNLKLLSMD-ASNLEMLPRGLLCRLSHLQVVKLPVQVQIPAEEIASLKELEQLHGRL 179 E+L+NLK L M A +EMLP+G+L +LQ + +P +++ P +E+ L ELE+ GR+ Sbjct: 546 EKLVNLKWLLMGGAFEMEMLPKGILLNFPYLQRLHIPDKIEAPLDELERLDELEEFSGRV 605 Query: 180 NSVCAFNCFIESRKHDD 230 S C FN FI+S++ + Sbjct: 606 KSRCDFNRFIQSQQRKE 622