BLASTX nr result
ID: Mentha27_contig00029995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00029995 (516 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28252.1| hypothetical protein MIMGU_mgv1a018333mg, partial... 61 1e-07 gb|EYU17859.1| hypothetical protein MIMGU_mgv1a008283mg [Mimulus... 61 1e-07 gb|EXC26757.1| hypothetical protein L484_023373 [Morus notabilis] 56 6e-06 gb|ABE01834.1| NAK-type protein kinase [Nicotiana tabacum] 56 6e-06 ref|XP_004245841.1| PREDICTED: probable receptor-like protein ki... 55 8e-06 >gb|EYU28252.1| hypothetical protein MIMGU_mgv1a018333mg, partial [Mimulus guttatus] Length = 377 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 1 AVPSIPWIRRLNIILGAAQGMQYLHEGLEVQV 96 AVP++PWI RLN+ILGAAQGM YLHEGLEVQV Sbjct: 181 AVPTVPWITRLNVILGAAQGMAYLHEGLEVQV 212 >gb|EYU17859.1| hypothetical protein MIMGU_mgv1a008283mg [Mimulus guttatus] Length = 379 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 1 AVPSIPWIRRLNIILGAAQGMQYLHEGLEVQV 96 AVP++PWI RLN+ILGAAQGM YLHEGLEVQV Sbjct: 181 AVPTVPWITRLNVILGAAQGMAYLHEGLEVQV 212 >gb|EXC26757.1| hypothetical protein L484_023373 [Morus notabilis] Length = 392 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 1 AVPSIPWIRRLNIILGAAQGMQYLHEGLEVQV 96 A PS+PWI+RL IILGAA+G+ YLHEGLE+QV Sbjct: 179 AFPSLPWIKRLQIILGAAEGLAYLHEGLELQV 210 >gb|ABE01834.1| NAK-type protein kinase [Nicotiana tabacum] Length = 412 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +1 Query: 1 AVPSIPWIRRLNIILGAAQGMQYLHEGLEVQV 96 AVP IPW RL IILGAAQGM YLHEGLEVQV Sbjct: 177 AVPVIPWKTRLKIILGAAQGMAYLHEGLEVQV 208 >ref|XP_004245841.1| PREDICTED: probable receptor-like protein kinase At5g47070-like [Solanum lycopersicum] Length = 409 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +1 Query: 1 AVPSIPWIRRLNIILGAAQGMQYLHEGLEVQV 96 AVP +PW RL IILGAAQGM YLHEGLEVQV Sbjct: 177 AVPVVPWRTRLKIILGAAQGMAYLHEGLEVQV 208