BLASTX nr result
ID: Mentha27_contig00029946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00029946 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38217.1| hypothetical protein MIMGU_mgv1a000533mg [Mimulus... 52 2e-07 >gb|EYU38217.1| hypothetical protein MIMGU_mgv1a000533mg [Mimulus guttatus] Length = 1091 Score = 52.0 bits (123), Expect(2) = 2e-07 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = +2 Query: 47 LKGNIREFSRCWPMKSDEIDGEASLAVDFEAANDGNNSKIEGSSQKKPLR 196 LKGNIR F RC P+ ++EI+G S+AVDFEA+ DG + + KK + Sbjct: 427 LKGNIRVFCRCRPLNTEEINGGVSVAVDFEASKDGELTILSNGISKKTFK 476 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = +3 Query: 3 QEVKEKKELYNQVLD*K 53 QEVK++KELYN+VL+ K Sbjct: 412 QEVKQRKELYNKVLELK 428