BLASTX nr result
ID: Mentha27_contig00029930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00029930 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFQ29635.1| bZIP transcription factor [Colletotrichum gramini... 58 2e-06 >gb|EFQ29635.1| bZIP transcription factor [Colletotrichum graminicola M1.001] Length = 264 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = -3 Query: 145 RQTPXXXXXQSERKNEAADTVLRRQRNTIAARKYRQKKFDRIEELE 8 R +P SE AD VLRRQRNTIAARKYRQKK DRI+ELE Sbjct: 182 RSSPNSDGRDSEMATPHADKVLRRQRNTIAARKYRQKKVDRIDELE 227