BLASTX nr result
ID: Mentha27_contig00029705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00029705 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36628.1| hypothetical protein MIMGU_mgv1a0068451mg, partia... 73 5e-11 gb|EYU22361.1| hypothetical protein MIMGU_mgv1a006444mg [Mimulus... 73 5e-11 gb|EYU36629.1| hypothetical protein MIMGU_mgv1a0068451mg, partia... 72 1e-10 ref|XP_006344947.1| PREDICTED: rab GDP dissociation inhibitor al... 72 1e-10 ref|XP_004251972.1| PREDICTED: rab GDP dissociation inhibitor al... 72 1e-10 ref|XP_004244786.1| PREDICTED: rab GDP dissociation inhibitor al... 72 1e-10 gb|AAW78520.1| GDP dissociation inhibitor 1 [Solanum chilense] 72 1e-10 gb|AAB80717.1| GDP dissociation inhibitor [Nicotiana tabacum] 72 1e-10 ref|NP_001274860.1| rab GDP dissociation inhibitor alpha-like [S... 72 1e-10 gb|ACN65853.1| Rab GDP dissociation inhibitor [Nicotiana bentham... 72 1e-10 gb|ABR16699.1| unknown [Picea sitchensis] 70 2e-10 ref|XP_006478491.1| PREDICTED: rab GDP dissociation inhibitor al... 70 3e-10 ref|XP_006441986.1| hypothetical protein CICLE_v10020158mg [Citr... 70 3e-10 gb|AHF81486.1| small GTP Rab-GDI [Mangifera indica] 69 7e-10 ref|XP_007202054.1| hypothetical protein PRUPE_ppa005772mg [Prun... 69 7e-10 ref|NP_001266078.1| rab GDP dissociation inhibitor alpha-like [C... 69 9e-10 ref|XP_006351084.1| PREDICTED: rab GDP dissociation inhibitor al... 68 1e-09 gb|AFK40299.1| unknown [Lotus japonicus] 68 1e-09 ref|XP_002513702.1| protein with unknown function [Ricinus commu... 68 1e-09 gb|ABK25073.1| unknown [Picea sitchensis] gi|148908153|gb|ABR171... 68 2e-09 >gb|EYU36628.1| hypothetical protein MIMGU_mgv1a0068451mg, partial [Mimulus guttatus] Length = 291 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P+YIMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGK+ Sbjct: 77 PKYIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKI 115 >gb|EYU22361.1| hypothetical protein MIMGU_mgv1a006444mg [Mimulus guttatus] Length = 444 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P+YIMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGK+ Sbjct: 77 PKYIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKI 115 >gb|EYU36629.1| hypothetical protein MIMGU_mgv1a0068451mg, partial [Mimulus guttatus] Length = 224 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 161 QYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 QYIMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGK+ Sbjct: 11 QYIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKI 48 >ref|XP_006344947.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum tuberosum] Length = 444 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >ref|XP_004251972.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum lycopersicum] Length = 444 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >ref|XP_004244786.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum lycopersicum] Length = 444 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >gb|AAW78520.1| GDP dissociation inhibitor 1 [Solanum chilense] Length = 444 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >gb|AAB80717.1| GDP dissociation inhibitor [Nicotiana tabacum] Length = 444 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >ref|NP_001274860.1| rab GDP dissociation inhibitor alpha-like [Solanum tuberosum] gi|82623395|gb|ABB87112.1| GDP dissociation inhibitor 1-like [Solanum tuberosum] Length = 444 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >gb|ACN65853.1| Rab GDP dissociation inhibitor [Nicotiana benthamiana] Length = 444 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >gb|ABR16699.1| unknown [Picea sitchensis] Length = 444 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/40 (75%), Positives = 38/40 (95%) Frame = -1 Query: 167 SPQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 SP+++MAN ALV +LIHTD+TKYLYF+AVDGS+VYNKGK+ Sbjct: 76 SPKFMMANGALVRVLIHTDVTKYLYFKAVDGSYVYNKGKI 115 >ref|XP_006478491.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Citrus sinensis] Length = 444 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++I+AN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >ref|XP_006441986.1| hypothetical protein CICLE_v10020158mg [Citrus clementina] gi|557544248|gb|ESR55226.1| hypothetical protein CICLE_v10020158mg [Citrus clementina] Length = 444 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++I+AN ALV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >gb|AHF81486.1| small GTP Rab-GDI [Mangifera indica] Length = 444 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P+++MAN LV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFMMANGGLVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >ref|XP_007202054.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica] gi|462397585|gb|EMJ03253.1| hypothetical protein PRUPE_ppa005772mg [Prunus persica] Length = 444 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P+++MAN LV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFMMANGTLVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >ref|NP_001266078.1| rab GDP dissociation inhibitor alpha-like [Cicer arietinum] gi|3175990|emb|CAA06731.1| GDP dissociation inhibitor [Cicer arietinum] Length = 444 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -1 Query: 167 SPQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 +P++IMAN LV +LIHTD+TKYLYF+AVDGSFV+NKGKV Sbjct: 76 NPKFIMANGMLVRVLIHTDVTKYLYFKAVDGSFVFNKGKV 115 >ref|XP_006351084.1| PREDICTED: rab GDP dissociation inhibitor alpha-like [Solanum tuberosum] Length = 444 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P++IMAN ALV +LIHTD+TKYL F+AVDGSFVYNKGKV Sbjct: 77 PKFIMANGALVRVLIHTDVTKYLSFKAVDGSFVYNKGKV 115 >gb|AFK40299.1| unknown [Lotus japonicus] Length = 370 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/40 (75%), Positives = 37/40 (92%) Frame = -1 Query: 167 SPQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 +P++IMAN LV +LIHTD+TKYLYF+AVDGSFV+NKGKV Sbjct: 2 NPKFIMANGNLVRVLIHTDVTKYLYFKAVDGSFVFNKGKV 41 >ref|XP_002513702.1| protein with unknown function [Ricinus communis] gi|223547153|gb|EEF48649.1| protein with unknown function [Ricinus communis] Length = 444 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P+++MAN LV +LIHTD+TKYLYF+AVDGSFVYNKGKV Sbjct: 77 PKFMMANGNLVRVLIHTDVTKYLYFKAVDGSFVYNKGKV 115 >gb|ABK25073.1| unknown [Picea sitchensis] gi|148908153|gb|ABR17192.1| unknown [Picea sitchensis] gi|224285911|gb|ACN40669.1| unknown [Picea sitchensis] Length = 444 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -1 Query: 164 PQYIMANCALVHILIHTDITKYLYFQAVDGSFVYNKGKV 48 P+++MAN +LV +LIHTD+TKYLYF+AVDGS+VYNKGK+ Sbjct: 77 PKFMMANGSLVRVLIHTDVTKYLYFKAVDGSYVYNKGKI 115