BLASTX nr result
ID: Mentha27_contig00029550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00029550 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21376.1| hypothetical protein MIMGU_mgv1a009903mg [Mimulus... 60 2e-07 >gb|EYU21376.1| hypothetical protein MIMGU_mgv1a009903mg [Mimulus guttatus] Length = 328 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = -3 Query: 226 ETGCEPDPGNLARXXXXXXXXXXXPKWNALFSKDEDVDDDPSGKSGSGQED 74 E+GC PDP NL R P+WN LFSK ED D+DP+ KSGSGQE+ Sbjct: 83 ESGCGPDPDNLTRSLLIEILPSSSPEWNTLFSKSEDFDEDPAEKSGSGQEE 133