BLASTX nr result
ID: Mentha27_contig00029518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00029518 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007159021.1| hypothetical protein PHAVU_002G201700g [Phas... 68 1e-09 emb|CAH10217.1| polygalacturonase inhibiting protein [Phaseolus ... 68 1e-09 ref|XP_003524769.1| PREDICTED: polygalacturonase inhibitor 2-lik... 67 2e-09 gb|ACI49697.1| polygalacturonase-inhibiting protein [Vaccinium c... 67 2e-09 gb|ABW89507.1| polygalacturonase inhibitor protein precursor [He... 67 3e-09 gb|ABW89506.1| polygalacturonase inhibitor protein precursor [He... 67 3e-09 gb|ABW89493.1| polygalacturonase inhibitor protein precursor [He... 67 3e-09 gb|ABW89490.1| polygalacturonase inhibitor protein precursor [He... 67 3e-09 gb|EYU23151.1| hypothetical protein MIMGU_mgv1a008706mg [Mimulus... 67 3e-09 emb|CAF04489.1| putative polygalacturonase-inhibiting protein [s... 67 3e-09 ref|XP_002322686.1| polygalacturonase inhibiting family protein ... 67 3e-09 gb|ABS18954.1| PGIP2 [Populus deltoides] 67 3e-09 ref|NP_196305.1| polygalacturonase inhibitor 2 [Arabidopsis thal... 66 4e-09 ref|XP_006290158.1| hypothetical protein CARUB_v10003826mg [Caps... 66 4e-09 ref|XP_007203885.1| hypothetical protein PRUPE_ppa008474mg [Prun... 66 4e-09 gb|AAB80732.1| polygalacturonase inhibiting protein [Prunus arme... 66 4e-09 gb|AAF69828.1|AF229250_1 polygalacturonase inhibiting protein 2 ... 66 4e-09 gb|ACY41031.1| polygalacturonase inhibiting protein [Prunus frut... 66 4e-09 gb|AAV33432.1| polygalacturonase inhibiting protein [Prunus mume] 66 4e-09 gb|AAQ56728.1| polygalacturonase inhibiting protein [Prunus pers... 66 4e-09 >ref|XP_007159021.1| hypothetical protein PHAVU_002G201700g [Phaseolus vulgaris] gi|55859507|emb|CAI11359.1| polygalacturonase inhibiting protein precursor [Phaseolus vulgaris] gi|561032436|gb|ESW31015.1| hypothetical protein PHAVU_002G201700g [Phaseolus vulgaris] Length = 337 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/53 (56%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -3 Query: 289 LPKDLSSTGII-ALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LPK L+S + +LNVSYN+LCG IP+ + Q FD ++++HNKCLCG PLP+C Sbjct: 284 LPKVLTSLKYLKSLNVSYNNLCGQIPQGGKLQRFDESSYAHNKCLCGSPLPSC 336 >emb|CAH10217.1| polygalacturonase inhibiting protein [Phaseolus vulgaris] Length = 337 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/53 (56%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -3 Query: 289 LPKDLSSTGII-ALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LPK L+S + +LNVSYN+LCG IP+ + Q FD ++++HNKCLCG PLP+C Sbjct: 284 LPKVLTSLKYLKSLNVSYNNLCGQIPQGGKLQRFDESSYAHNKCLCGSPLPSC 336 >ref|XP_003524769.1| PREDICTED: polygalacturonase inhibitor 2-like [Glycine max] Length = 335 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/54 (55%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 289 LPKDLSST-GIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 LPK L+S + L+VSYN+LCG IP + Q FD++ ++HNKCLCG PLP+CK Sbjct: 280 LPKGLTSLKDLYYLDVSYNNLCGKIPRGGKLQEFDASTYAHNKCLCGSPLPSCK 333 >gb|ACI49697.1| polygalacturonase-inhibiting protein [Vaccinium corymbosum] Length = 329 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LP++L++ LNVSYN LCG IP + Q+F +T++ HNKCLCG PLPAC Sbjct: 278 LPEELTALNFQYLNVSYNRLCGKIPTGGKLQSFAATSYFHNKCLCGAPLPAC 329 >gb|ABW89507.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] Length = 312 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LP+ L+ + ALNVSYN LCG IP R Q +D+TA+ HN+CLCG PL AC Sbjct: 260 LPETLTGLKLEALNVSYNRLCGEIPTGGRLQNYDNTAYFHNRCLCGFPLAAC 311 >gb|ABW89506.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] Length = 312 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LP+ L+ + ALNVSYN LCG IP R Q +D+TA+ HN+CLCG PL AC Sbjct: 260 LPETLTGLKLEALNVSYNRLCGEIPTGGRLQNYDNTAYFHNRCLCGFPLAAC 311 >gb|ABW89493.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139039|gb|ABW89495.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139047|gb|ABW89499.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] Length = 312 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LP+ L+ + ALNVSYN LCG IP R Q +D+TA+ HN+CLCG PL AC Sbjct: 260 LPETLTGLKLEALNVSYNRLCGEIPTGGRLQNYDNTAYFHNRCLCGFPLAAC 311 >gb|ABW89490.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139031|gb|ABW89491.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139033|gb|ABW89492.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139041|gb|ABW89496.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139043|gb|ABW89497.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139053|gb|ABW89502.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139055|gb|ABW89503.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139057|gb|ABW89504.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] gi|159139065|gb|ABW89508.1| polygalacturonase inhibitor protein precursor [Helianthus annuus] Length = 312 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LP+ L+ + ALNVSYN LCG IP R Q +D+TA+ HN+CLCG PL AC Sbjct: 260 LPETLTGLKLEALNVSYNRLCGEIPTGGRLQNYDNTAYFHNRCLCGFPLAAC 311 >gb|EYU23151.1| hypothetical protein MIMGU_mgv1a008706mg [Mimulus guttatus] Length = 365 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -3 Query: 289 LPKDLSSTG-IIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPAC 134 LP+ L+ G +I+LNVSYN LCG IP R Q F++T++ HN+CLCG PLP C Sbjct: 313 LPEGLAELGNLISLNVSYNRLCGKIPVGGRLQDFETTSYFHNRCLCGAPLPKC 365 >emb|CAF04489.1| putative polygalacturonase-inhibiting protein [synthetic construct] Length = 332 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/53 (50%), Positives = 38/53 (71%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P +L+ + NVSYN LCG IP + Q+FD+T++ HN+CLCG PLP+CK Sbjct: 280 IPDELTQVKLQFFNVSYNRLCGQIPVGGKLQSFDNTSYFHNRCLCGTPLPSCK 332 >ref|XP_002322686.1| polygalacturonase inhibiting family protein [Populus trichocarpa] gi|222867316|gb|EEF04447.1| polygalacturonase inhibiting family protein [Populus trichocarpa] Length = 326 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P ++ ++LNVSYN LCG IP+ + QT D TA+ HN+CLCG PL +CK Sbjct: 274 IPTQMTQLNYLSLNVSYNRLCGQIPQGGKLQTLDYTAYFHNRCLCGAPLASCK 326 >gb|ABS18954.1| PGIP2 [Populus deltoides] Length = 326 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/53 (50%), Positives = 37/53 (69%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P ++ ++LNVSYN LCG IP+ + QT D TA+ HN+CLCG PL +CK Sbjct: 274 IPTQMTQLNYLSLNVSYNRLCGQIPQGGKLQTLDYTAYFHNRCLCGAPLASCK 326 >ref|NP_196305.1| polygalacturonase inhibitor 2 [Arabidopsis thaliana] gi|21263837|sp|Q9M5J8.2|PGIP2_ARATH RecName: Full=Polygalacturonase inhibitor 2; AltName: Full=Polygalacturonase-inhibiting protein 2; Short=PGIP-2; Flags: Precursor gi|9759543|dbj|BAB11145.1| polygalacturonase inhibiting protein [Arabidopsis thaliana] gi|14334896|gb|AAK59626.1| putative polygalacturonase inhibiting protein [Arabidopsis thaliana] gi|21280955|gb|AAM44964.1| putative polygalacturonase inhibiting protein [Arabidopsis thaliana] gi|332003694|gb|AED91077.1| polygalacturonase inhibitor 2 [Arabidopsis thaliana] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P + S LNVSYN LCG IP+ Q FDS +F HNKCLCG PLP+CK Sbjct: 278 IPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFFHNKCLCGAPLPSCK 330 >ref|XP_006290158.1| hypothetical protein CARUB_v10003826mg [Capsella rubella] gi|482558864|gb|EOA23056.1| hypothetical protein CARUB_v10003826mg [Capsella rubella] Length = 332 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P + S LNVSYN LCG IP+ Q FDS +F HNKCLCG PLP+CK Sbjct: 280 IPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFLHNKCLCGAPLPSCK 332 >ref|XP_007203885.1| hypothetical protein PRUPE_ppa008474mg [Prunus persica] gi|462399416|gb|EMJ05084.1| hypothetical protein PRUPE_ppa008474mg [Prunus persica] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P L+ + LNVSYN LCG IP + Q+FDS+ + HN+CLCG PLP+CK Sbjct: 278 IPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAB80732.1| polygalacturonase inhibiting protein [Prunus armeniaca] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P L+ + LNVSYN LCG IP + Q+FDS+ + HN+CLCG PLP+CK Sbjct: 278 IPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAF69828.1|AF229250_1 polygalacturonase inhibiting protein 2 [Arabidopsis thaliana] gi|21593044|gb|AAM64993.1| polygalacturonase inhibiting protein [Arabidopsis thaliana] Length = 326 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P + S LNVSYN LCG IP+ Q FDS +F HNKCLCG PLP+CK Sbjct: 274 IPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFFHNKCLCGAPLPSCK 326 >gb|ACY41031.1| polygalacturonase inhibiting protein [Prunus fruticosa] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P L+ + LNVSYN LCG IP + Q+FDS+ + HN+CLCG PLP+CK Sbjct: 278 IPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAV33432.1| polygalacturonase inhibiting protein [Prunus mume] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P L+ + LNVSYN LCG IP + Q+FDS+ + HN+CLCG PLP+CK Sbjct: 278 IPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330 >gb|AAQ56728.1| polygalacturonase inhibiting protein [Prunus persica] Length = 330 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -3 Query: 289 LPKDLSSTGIIALNVSYNSLCGPIPELRRFQTFDSTAFSHNKCLCGKPLPACK 131 +P L+ + LNVSYN LCG IP + Q+FDS+ + HN+CLCG PLP+CK Sbjct: 278 IPVGLTQVDLQFLNVSYNRLCGQIPVGGKLQSFDSSTYFHNRCLCGAPLPSCK 330