BLASTX nr result
ID: Mentha27_contig00029154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00029154 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31521.1| hypothetical protein MIMGU_mgv1a001985mg [Mimulus... 74 2e-11 ref|XP_007221278.1| hypothetical protein PRUPE_ppa001880mg [Prun... 57 2e-06 >gb|EYU31521.1| hypothetical protein MIMGU_mgv1a001985mg [Mimulus guttatus] Length = 730 Score = 73.9 bits (180), Expect = 2e-11 Identities = 41/84 (48%), Positives = 52/84 (61%), Gaps = 2/84 (2%) Frame = +1 Query: 7 SLSISCHPMLASSYLLSNQHRLISSHLLFKKGGRFAVSRSR--RVYCDSQTNHAQTRKYA 180 SLS S P L S LL H+ I LL K F V++ R RV CDSQT + RK++ Sbjct: 8 SLSSSYEPTLVLSQLLLAHHKSIRPPLLNNKRRGFVVAKPRNFRVRCDSQTKEIEIRKFS 67 Query: 181 PVLESEIVSGNELLPSNEWKTVPD 252 PVLES+++ GN +LPSNE T+PD Sbjct: 68 PVLESDVIQGNGVLPSNELTTIPD 91 >ref|XP_007221278.1| hypothetical protein PRUPE_ppa001880mg [Prunus persica] gi|462417912|gb|EMJ22477.1| hypothetical protein PRUPE_ppa001880mg [Prunus persica] Length = 748 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 4/76 (5%) Frame = +1 Query: 37 ASSYLLSNQHRLISSHLLFKK----GGRFAVSRSRRVYCDSQTNHAQTRKYAPVLESEIV 204 A +L SN H+ S + +K G F+++R R++C S+T Q R+Y+P LES ++ Sbjct: 39 ALQFLCSN-HKFRSRQIFLRKCYGSRGGFSLNRGFRLFCQSKTEEMQIRRYSPFLESVLL 97 Query: 205 SGNELLPSNEWKTVPD 252 N+ SNEW+ VPD Sbjct: 98 DANDASVSNEWRAVPD 113