BLASTX nr result
ID: Mentha27_contig00027853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00027853 (922 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27898.1| hypothetical protein MIMGU_mgv1a018665mg, partial... 77 7e-12 ref|XP_002316659.2| hypothetical protein POPTR_0011s04270g [Popu... 61 5e-07 ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [A... 58 5e-06 >gb|EYU27898.1| hypothetical protein MIMGU_mgv1a018665mg, partial [Mimulus guttatus] Length = 456 Score = 77.4 bits (189), Expect = 7e-12 Identities = 37/91 (40%), Positives = 55/91 (60%) Frame = +1 Query: 349 DVIKKIFSFLPFKKALHHSIQSKRLRNSWKLCRDLSFKIEVVRNLSRDEYRNIIENFFNN 528 DV+ IFS LP K+ SI S R R SWK CR+LSF +S ++++N + FF + Sbjct: 21 DVLDSIFSHLPIKEVRDLSILSHRFRYSWKFCRNLSFDRHFAGTMSTEKFKNSVNYFFKH 80 Query: 529 QLNTCADRLKFCYDATFEGNLISFW*EKQLN 621 +T AD+ + +DAT + NL+S W +K +N Sbjct: 81 HRSTSADKFRLYFDATNDVNLVSCWTQKAVN 111 >ref|XP_002316659.2| hypothetical protein POPTR_0011s04270g [Populus trichocarpa] gi|550327563|gb|EEE97271.2| hypothetical protein POPTR_0011s04270g [Populus trichocarpa] Length = 495 Score = 61.2 bits (147), Expect = 5e-07 Identities = 30/90 (33%), Positives = 46/90 (51%) Frame = +1 Query: 349 DVIKKIFSFLPFKKALHHSIQSKRLRNSWKLCRDLSFKIEVVRNLSRDEYRNIIENFFNN 528 DV+ IFSFLP KKA+ I S R +NSW R L F + R S +++++I+ F+ Sbjct: 49 DVLDMIFSFLPIKKAMQIGILSTRFKNSWNFNRRLDFDNDFARGRSPEDFKSIVNKVFDR 108 Query: 529 QLNTCADRLKFCYDATFEGNLISFW*EKQL 618 + + C+D E L+ W K + Sbjct: 109 HAGSRILSFRLCFDPNREELLVEKWIRKSI 138 >ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda] gi|548855467|gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda] Length = 734 Score = 58.2 bits (139), Expect = 5e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 781 FAKSEFAAGFFIVMYVITPISY*TDLYDAKSFPIFSE 891 FA + AAGFFIVMYVITP+SY DLY AK FPIFSE Sbjct: 285 FATANVAAGFFIVMYVITPLSYWLDLYHAKRFPIFSE 321