BLASTX nr result
ID: Mentha27_contig00027795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00027795 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45031.1| hypothetical protein MIMGU_mgv1a017619mg [Mimulus... 89 6e-16 gb|EPS71393.1| hypothetical protein M569_03373 [Genlisea aurea] 76 4e-12 ref|XP_002316854.1| hypothetical protein POPTR_0011s11040g [Popu... 66 4e-09 ref|XP_006477760.1| PREDICTED: uncharacterized protein LOC102626... 65 1e-08 gb|EXB22357.1| hypothetical protein L484_004350 [Morus notabilis] 63 4e-08 ref|XP_003543206.1| PREDICTED: uncharacterized protein LOC100801... 63 4e-08 ref|XP_007149573.1| hypothetical protein PHAVU_005G081700g [Phas... 62 8e-08 ref|XP_004489017.1| PREDICTED: uncharacterized protein LOC101494... 62 8e-08 ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854... 62 8e-08 ref|XP_002892929.1| hypothetical protein ARALYDRAFT_312664 [Arab... 61 2e-07 ref|NP_001117299.1| uncharacterized protein [Arabidopsis thalian... 60 2e-07 gb|ABD32939.1| hypothetical protein MtrDRAFT_AC151598g7v2 [Medic... 58 1e-06 ref|XP_003596333.1| hypothetical protein MTR_2g076020 [Medicago ... 58 1e-06 ref|XP_006303491.1| hypothetical protein CARUB_v10010818mg [Caps... 58 2e-06 >gb|EYU45031.1| hypothetical protein MIMGU_mgv1a017619mg [Mimulus guttatus] Length = 62 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 1/60 (1%) Frame = +3 Query: 54 IPLPPGEEVGPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEK-EQQMNESSSENPSAV 230 IP+ GEEV PKLVRLLYFVGAGV+CTAAINKWKE ERK++++K EQQ+N+ +NPS V Sbjct: 2 IPVAAGEEVAPKLVRLLYFVGAGVICTAAINKWKELERKALIQKEEQQLNQPPLDNPSTV 61 >gb|EPS71393.1| hypothetical protein M569_03373 [Genlisea aurea] Length = 60 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/59 (61%), Positives = 47/59 (79%) Frame = +3 Query: 54 IPLPPGEEVGPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNESSSENPSAV 230 +P+PPGEEV PKL+RLL+FVGAGV+ A INKWKE E+KS ++K Q +E+SS + AV Sbjct: 3 VPVPPGEEVAPKLIRLLWFVGAGVLSVAGINKWKELEKKSAIQK--QTDETSSSDSKAV 59 >ref|XP_002316854.1| hypothetical protein POPTR_0011s11040g [Populus trichocarpa] gi|222859919|gb|EEE97466.1| hypothetical protein POPTR_0011s11040g [Populus trichocarpa] Length = 71 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +3 Query: 81 GPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNESSSE 215 GPK++RLLYFVGAG +CT INKW+E ERKS+LE++QQ + S+ Sbjct: 12 GPKVLRLLYFVGAGFICTVGINKWREIERKSILEQQQQEKKMKSD 56 >ref|XP_006477760.1| PREDICTED: uncharacterized protein LOC102626014 [Citrus sinensis] Length = 67 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/65 (47%), Positives = 45/65 (69%), Gaps = 5/65 (7%) Frame = +3 Query: 69 GEEV-----GPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNESSSENPSAVV 233 GEE+ G K++R LYFVGAG +CTAAINKW+E ERKS+ +K+Q+ + + +N + V Sbjct: 3 GEEMASGPAGTKVLRFLYFVGAGFICTAAINKWRELERKSLQKKQQESDLLTDDNSATAV 62 Query: 234 PTAVE 248 V+ Sbjct: 63 QKVVK 67 >gb|EXB22357.1| hypothetical protein L484_004350 [Morus notabilis] Length = 58 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/56 (51%), Positives = 41/56 (73%), Gaps = 5/56 (8%) Frame = +3 Query: 69 GEE----VGPKLVRLLYFVGAGVVCTAAINKWKEYERKSML-EKEQQMNESSSENP 221 GEE GPKLVRLLYFVGAG +C INKW++++RKSML + +Q++++ + P Sbjct: 3 GEEFSGPAGPKLVRLLYFVGAGFICVVGINKWRDFQRKSMLSQHDQKLHQQQQKQP 58 >ref|XP_003543206.1| PREDICTED: uncharacterized protein LOC100801381 isoform X1 [Glycine max] gi|571500950|ref|XP_006594729.1| PREDICTED: uncharacterized protein LOC100801381 isoform X2 [Glycine max] Length = 67 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/65 (47%), Positives = 49/65 (75%), Gaps = 5/65 (7%) Frame = +3 Query: 69 GEEV----GPKLVRLLYFVGAGVVCTAAINKWKEYERKSML-EKEQQMNESSSENPSAVV 233 GEE+ GPKL+RL+ FVGA V+CTAAINK++EYER +++ +++QQ+ E+ + + S V Sbjct: 3 GEEISGPAGPKLLRLVSFVGAAVICTAAINKYREYERNTIIKQQQQQVVETHNSSESVAV 62 Query: 234 PTAVE 248 P ++ Sbjct: 63 PKTLK 67 >ref|XP_007149573.1| hypothetical protein PHAVU_005G081700g [Phaseolus vulgaris] gi|593698202|ref|XP_007149574.1| hypothetical protein PHAVU_005G081700g [Phaseolus vulgaris] gi|561022837|gb|ESW21567.1| hypothetical protein PHAVU_005G081700g [Phaseolus vulgaris] gi|561022838|gb|ESW21568.1| hypothetical protein PHAVU_005G081700g [Phaseolus vulgaris] Length = 70 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 6/55 (10%) Frame = +3 Query: 81 GPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNE------SSSENPSA 227 GPKL RL++F+GA V+CT AINKW+EYER ++++++QQ + +SSE+ +A Sbjct: 11 GPKLFRLVFFIGAAVICTTAINKWREYERNTIVQQQQQQQQRVVETHNSSESVAA 65 >ref|XP_004489017.1| PREDICTED: uncharacterized protein LOC101494005 isoform X1 [Cicer arietinum] gi|502089786|ref|XP_004489018.1| PREDICTED: uncharacterized protein LOC101494005 isoform X2 [Cicer arietinum] gi|502089789|ref|XP_004489019.1| PREDICTED: uncharacterized protein LOC101494005 isoform X3 [Cicer arietinum] gi|502089792|ref|XP_004489020.1| PREDICTED: uncharacterized protein LOC101494005 isoform X4 [Cicer arietinum] Length = 69 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +3 Query: 81 GPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNESSSENPSAVVPTAV 245 GPKL RL+YFVGA V CT AINKW+E+ER S++ ++Q++ + +E PS+ AV Sbjct: 11 GPKLTRLVYFVGAAVACTVAINKWREFERNSIIRQQQEV-KGVAEIPSSSDSVAV 64 >ref|XP_003634663.1| PREDICTED: uncharacterized protein LOC100854863 [Vitis vinifera] gi|302142887|emb|CBI20182.3| unnamed protein product [Vitis vinifera] Length = 58 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +3 Query: 69 GEEVGPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNESSSEN 218 G GPK++R+LYFVGAG +CTAAINKW++ +RKS + Q+ E + N Sbjct: 6 GGPAGPKVLRMLYFVGAGFICTAAINKWRDLQRKSAQQHADQLPEKPANN 55 >ref|XP_002892929.1| hypothetical protein ARALYDRAFT_312664 [Arabidopsis lyrata subsp. lyrata] gi|297338771|gb|EFH69188.1| hypothetical protein ARALYDRAFT_312664 [Arabidopsis lyrata subsp. lyrata] Length = 69 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/44 (54%), Positives = 36/44 (81%) Frame = +3 Query: 84 PKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNESSSE 215 PK++R++YFVGAG +CT AINKW+E ER S+L++EQ+ N+ + Sbjct: 9 PKMLRMVYFVGAGFLCTFAINKWREMERNSLLKQEQEKNQQHGD 52 >ref|NP_001117299.1| uncharacterized protein [Arabidopsis thaliana] gi|332191400|gb|AEE29521.1| uncharacterized protein AT1G16916 [Arabidopsis thaliana] Length = 65 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = +3 Query: 84 PKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNE 203 PK++R++YFVGAG +CT AINKW+E ER S+L++EQ+ N+ Sbjct: 9 PKMLRMVYFVGAGFLCTFAINKWREMERNSLLKQEQEKNQ 48 >gb|ABD32939.1| hypothetical protein MtrDRAFT_AC151598g7v2 [Medicago truncatula] Length = 72 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +3 Query: 81 GPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQ 194 GPKL+RL+YFVGA V T AINKW+E+E KS+++++QQ Sbjct: 11 GPKLMRLVYFVGAAVAVTVAINKWREFESKSIIQQQQQ 48 >ref|XP_003596333.1| hypothetical protein MTR_2g076020 [Medicago truncatula] gi|355485381|gb|AES66584.1| hypothetical protein MTR_2g076020 [Medicago truncatula] Length = 89 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = +3 Query: 81 GPKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQ 194 GPKL+RL+YFVGA V T AINKW+E+E KS+++++QQ Sbjct: 11 GPKLMRLVYFVGAAVAVTVAINKWREFESKSIIQQQQQ 48 >ref|XP_006303491.1| hypothetical protein CARUB_v10010818mg [Capsella rubella] gi|482572202|gb|EOA36389.1| hypothetical protein CARUB_v10010818mg [Capsella rubella] Length = 68 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/40 (57%), Positives = 34/40 (85%) Frame = +3 Query: 84 PKLVRLLYFVGAGVVCTAAINKWKEYERKSMLEKEQQMNE 203 PK++R++YFVGAG +CT AINKW+E ER S+L++EQ+ + Sbjct: 9 PKILRMVYFVGAGFLCTFAINKWREMERNSLLKEEQKSQQ 48