BLASTX nr result
ID: Mentha27_contig00027658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00027658 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42837.1| hypothetical protein MIMGU_mgv1a000292mg [Mimulus... 57 2e-06 >gb|EYU42837.1| hypothetical protein MIMGU_mgv1a000292mg [Mimulus guttatus] Length = 1290 Score = 57.4 bits (137), Expect = 2e-06 Identities = 36/53 (67%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -2 Query: 172 MAEEALPSQEIP--KSAEEVESNGVLPVKIIE--GKTVEETAMEGEFVKVEKE 26 MAEE + S EIP K A E ESNGV P+KIIE K EETA+EGEFVKVEKE Sbjct: 1 MAEETVISHEIPAAKLANEAESNGV-PIKIIEEEAKKEEETALEGEFVKVEKE 52