BLASTX nr result
ID: Mentha27_contig00027619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00027619 (225 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44552.1| hypothetical protein MIMGU_mgv1a010377mg [Mimulus... 60 3e-07 >gb|EYU44552.1| hypothetical protein MIMGU_mgv1a010377mg [Mimulus guttatus] Length = 314 Score = 60.1 bits (144), Expect = 3e-07 Identities = 39/108 (36%), Positives = 50/108 (46%), Gaps = 36/108 (33%) Frame = -2 Query: 218 PPVAASQPNPDYLFGFDKEYQPSVGPPLYLSQIPIPPENGGRV----------------- 90 PPV+++ NPDYLFGFD+EY+PSV PP L Q IPPEN G Sbjct: 176 PPVSSAPSNPDYLFGFDEEYKPSVDPPPDLLQ--IPPENWGSFSPCEGKKVISKIGGEKG 233 Query: 89 ------------------AEIPAAAQAVYRVPAGVNEGA-YRSGAYSF 3 A + +A+YR P VN G YR+G Y++ Sbjct: 234 IAKSHVDSRGINSESVGWAPVVTTTEAIYRGPVVVNGGGMYRTGNYAY 281