BLASTX nr result
ID: Mentha27_contig00027597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00027597 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK44913.1| unknown [Lotus japonicus] 63 4e-08 gb|AFK44024.1| unknown [Lotus japonicus] 63 4e-08 ref|XP_007225691.1| hypothetical protein PRUPE_ppa008519mg [Prun... 63 5e-08 gb|AAK70805.1| leucine-rich repeat resistance protein-like prote... 63 5e-08 ref|XP_007037491.1| Leucine-rich repeat family protein isoform 2... 62 6e-08 ref|XP_007037490.1| Leucine-rich repeat (LRR) family protein iso... 62 6e-08 ref|XP_003614019.1| Leucine-rich repeat receptor protein kinase ... 62 6e-08 ref|XP_006477621.1| PREDICTED: probable leucine-rich repeat rece... 62 8e-08 ref|XP_006440692.1| hypothetical protein CICLE_v10021138mg [Citr... 62 8e-08 ref|XP_004297259.1| PREDICTED: probable leucine-rich repeat rece... 62 1e-07 gb|AFK49363.1| unknown [Medicago truncatula] 61 1e-07 ref|XP_002269214.1| PREDICTED: probable leucine-rich repeat rece... 61 2e-07 ref|XP_007157582.1| hypothetical protein PHAVU_002G081300g [Phas... 60 2e-07 ref|XP_006359580.1| PREDICTED: probable leucine-rich repeat rece... 60 3e-07 ref|XP_004157333.1| PREDICTED: probable leucine-rich repeat rece... 60 3e-07 ref|XP_004143790.1| PREDICTED: probable leucine-rich repeat rece... 60 3e-07 ref|XP_004490152.1| PREDICTED: probable leucine-rich repeat rece... 60 4e-07 ref|XP_003518760.1| PREDICTED: probable leucine-rich repeat rece... 60 4e-07 ref|NP_001239691.1| probable leucine-rich repeat receptor-like p... 60 4e-07 gb|EXB65078.1| hypothetical protein L484_004254 [Morus notabilis] 59 5e-07 >gb|AFK44913.1| unknown [Lotus japonicus] Length = 91 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGVKPIG HKVLE++DS+FLV Sbjct: 58 FLKEMYIEGNAFRPGVKPIGFHKVLEVSDSDFLV 91 >gb|AFK44024.1| unknown [Lotus japonicus] Length = 329 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGVKPIG HKVLE++DS+FLV Sbjct: 296 FLKEMYIEGNAFRPGVKPIGFHKVLEVSDSDFLV 329 >ref|XP_007225691.1| hypothetical protein PRUPE_ppa008519mg [Prunus persica] gi|462422627|gb|EMJ26890.1| hypothetical protein PRUPE_ppa008519mg [Prunus persica] Length = 328 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLK++YIEGN+FRPGVKPIG HKVLEL D+EFLV Sbjct: 295 FLKDMYIEGNAFRPGVKPIGIHKVLELTDTEFLV 328 >gb|AAK70805.1| leucine-rich repeat resistance protein-like protein [Gossypium hirsutum] Length = 328 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKELYIEGN+FRPGV PIG HKVLEL+D++FLV Sbjct: 295 FLKELYIEGNAFRPGVNPIGAHKVLELSDADFLV 328 >ref|XP_007037491.1| Leucine-rich repeat family protein isoform 2 [Theobroma cacao] gi|508774736|gb|EOY21992.1| Leucine-rich repeat family protein isoform 2 [Theobroma cacao] Length = 302 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKELYIEGN FRPGV PIG HKVLEL+D++FLV Sbjct: 269 FLKELYIEGNGFRPGVNPIGPHKVLELSDTDFLV 302 >ref|XP_007037490.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma cacao] gi|508774735|gb|EOY21991.1| Leucine-rich repeat (LRR) family protein isoform 1 [Theobroma cacao] Length = 326 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKELYIEGN FRPGV PIG HKVLEL+D++FLV Sbjct: 293 FLKELYIEGNGFRPGVNPIGPHKVLELSDTDFLV 326 >ref|XP_003614019.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] gi|355515354|gb|AES96977.1| Leucine-rich repeat receptor protein kinase EXS [Medicago truncatula] Length = 329 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGV PIG HKVLE++DSEFLV Sbjct: 296 FLKEMYIEGNAFRPGVNPIGLHKVLEVSDSEFLV 329 >ref|XP_006477621.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Citrus sinensis] Length = 326 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGV PIG HKVLEL D+EFLV Sbjct: 293 FLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFLV 326 >ref|XP_006440692.1| hypothetical protein CICLE_v10021138mg [Citrus clementina] gi|557542954|gb|ESR53932.1| hypothetical protein CICLE_v10021138mg [Citrus clementina] Length = 326 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGV PIG HKVLEL D+EFLV Sbjct: 293 FLKEMYIEGNAFRPGVNPIGIHKVLELTDTEFLV 326 >ref|XP_004297259.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Fragaria vesca subsp. vesca] Length = 329 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLK++YIEGN+F+PGVKPIG HKVLEL D+EFLV Sbjct: 296 FLKDMYIEGNAFKPGVKPIGIHKVLELTDTEFLV 329 >gb|AFK49363.1| unknown [Medicago truncatula] Length = 71 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGV PIG HKVLE+ DSEFLV Sbjct: 38 FLKEMYIEGNAFRPGVNPIGLHKVLEVFDSEFLV 71 >ref|XP_002269214.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710 [Vitis vinifera] gi|297738074|emb|CBI27275.3| unnamed protein product [Vitis vinifera] Length = 329 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFL 101 FLKE+YIEGN+FRPGVKPIG HKVLE++D++FL Sbjct: 296 FLKEMYIEGNAFRPGVKPIGVHKVLEVSDTDFL 328 >ref|XP_007157582.1| hypothetical protein PHAVU_002G081300g [Phaseolus vulgaris] gi|561030997|gb|ESW29576.1| hypothetical protein PHAVU_002G081300g [Phaseolus vulgaris] Length = 356 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN FRPGV PIG HKVLE++DS+FLV Sbjct: 323 FLKEMYIEGNVFRPGVNPIGYHKVLEVSDSDFLV 356 >ref|XP_006359580.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Solanum tuberosum] Length = 331 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIE N+FRPGVKPIG HKVLEL+D++FLV Sbjct: 298 FLKEMYIEENTFRPGVKPIGLHKVLELSDADFLV 331 >ref|XP_004157333.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Length = 227 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FR GVKPIG HKVLE++D+EFLV Sbjct: 194 FLKEMYIEGNAFRQGVKPIGFHKVLEVSDAEFLV 227 >ref|XP_004143790.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Length = 330 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FR GVKPIG HKVLE++D+EFLV Sbjct: 297 FLKEMYIEGNAFRQGVKPIGFHKVLEVSDAEFLV 330 >ref|XP_004490152.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cicer arietinum] Length = 329 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPG PIG HKVLE++DS+FLV Sbjct: 296 FLKEMYIEGNAFRPGANPIGLHKVLEVSDSDFLV 329 >ref|XP_003518760.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like isoform 1 [Glycine max] Length = 329 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGV PIG HKVLE++D +FLV Sbjct: 296 FLKEMYIEGNAFRPGVNPIGFHKVLEVSDGDFLV 329 >ref|NP_001239691.1| probable leucine-rich repeat receptor-like protein kinase At1g35710-like precursor [Glycine max] gi|223452556|gb|ACM89605.1| leucine-rich repeat resistance protein-like protein [Glycine max] Length = 329 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGN+FRPGV PIG HKVLE++D +FLV Sbjct: 296 FLKEMYIEGNAFRPGVNPIGFHKVLEVSDGDFLV 329 >gb|EXB65078.1| hypothetical protein L484_004254 [Morus notabilis] Length = 329 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 FLKELYIEGNSFRPGVKPIGEHKVLELADSEFLV 104 FLKE+YIEGNSFR GV PIG HKVLEL D++FLV Sbjct: 296 FLKEMYIEGNSFRSGVNPIGVHKVLELTDTDFLV 329