BLASTX nr result
ID: Mentha27_contig00027532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00027532 (203 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35916.1| hypothetical protein MIMGU_mgv1a009371mg [Mimulus... 64 3e-08 >gb|EYU35916.1| hypothetical protein MIMGU_mgv1a009371mg [Mimulus guttatus] Length = 344 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +2 Query: 59 LLILFVATSAVVCQL-PGHVGVCNGRVGNNLPSEQDVVQLYNLNGIKKM 202 L+I F A S V+CQ G +GVCNGRVG NLP E+DVV+ Y NGIK+M Sbjct: 11 LIIFFAAVSGVLCQSNQGTIGVCNGRVGGNLPPEKDVVEFYKTNGIKRM 59