BLASTX nr result
ID: Mentha27_contig00026997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026997 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007199173.1| hypothetical protein PRUPE_ppa021397mg [Prun... 57 2e-06 >ref|XP_007199173.1| hypothetical protein PRUPE_ppa021397mg [Prunus persica] gi|462394573|gb|EMJ00372.1| hypothetical protein PRUPE_ppa021397mg [Prunus persica] Length = 474 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/60 (48%), Positives = 37/60 (61%) Frame = +2 Query: 191 IEFPSAKVVIXXXXXXXXXXMFVRSVARDLLPSELSHYASAKLSQFLSTFSNEATLLIDE 370 +E PSAK VI M +RS ARD +PSEL HY S KL LS+ S++ TL+I+E Sbjct: 1 MEMPSAKTVISTATSVAAAAMLIRSTARDWVPSELQHYVSLKLRSLLSSLSSQLTLVIEE 60