BLASTX nr result
ID: Mentha27_contig00026994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026994 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43905.1| hypothetical protein MIMGU_mgv1a008893mg [Mimulus... 75 7e-12 >gb|EYU43905.1| hypothetical protein MIMGU_mgv1a008893mg [Mimulus guttatus] gi|604345324|gb|EYU43906.1| hypothetical protein MIMGU_mgv1a008893mg [Mimulus guttatus] Length = 359 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/54 (68%), Positives = 41/54 (75%) Frame = -2 Query: 163 MERRRWFIIAILICSVTLASCRELKVTVKHKHNSKQHQLATYNHTLATILVQYA 2 MERRR I+ I IC +SCRELKV VKH H + H+LATYNHTLATILVQYA Sbjct: 1 MERRRMLIVVIFICMFAFSSCRELKVKVKH-HQIQHHELATYNHTLATILVQYA 53