BLASTX nr result
ID: Mentha27_contig00026842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026842 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGE09572.1| cellulose synthase-like protein [Eucalyptus clado... 75 2e-21 dbj|BAM05565.1| cellulose synthase 1, partial [Eucalyptus pilula... 75 2e-21 gb|AAL37718.1|AF413210_1 cellulose synthase A4 [Gossypium hirsutum] 73 4e-21 gb|AFR58754.1| cellulose synthase 1 [Eucalyptus tereticornis] 73 6e-21 gb|AGJ71352.1| cellulose synthase 1 [Eucalyptus urophylla] 73 6e-21 gb|AAY60843.1| cellulose synthase 1 [Eucalyptus grandis] gi|1629... 73 6e-21 gb|AEK31215.1| cellulose synthase A [Eucalyptus camaldulensis] 73 6e-21 dbj|BAK14406.1| cellulose synthase catalytic subunit [Eucalyptus... 73 6e-21 dbj|BAM05567.1| cellulose synthase 1, partial [Eucalyptus globul... 73 6e-21 ref|XP_002269610.2| PREDICTED: cellulose synthase A catalytic su... 74 8e-21 gb|EYU28107.1| hypothetical protein MIMGU_mgv1a000793mg [Mimulus... 72 8e-21 emb|CBI30712.3| unnamed protein product [Vitis vinifera] 74 8e-21 gb|AEE60894.1| cellulose synthase [Populus tomentosa] 71 2e-20 gb|AEE60893.1| cellulose synthase [Populus tomentosa] 71 2e-20 ref|XP_002316815.1| hypothetical protein POPTR_0011s07040g [Popu... 71 2e-20 gb|AAT09896.2| cellulose synthase [Populus tremula x Populus tre... 71 2e-20 gb|AFZ78552.1| cellulose synthase [Populus tomentosa] 71 2e-20 ref|XP_007025329.1| Cellulose synthase family protein isoform 1 ... 70 2e-20 gb|AFZ78566.1| cellulose synthase [Populus tomentosa] 70 2e-20 gb|AAT09897.1| cellulose synthase [Populus tremula x Populus tre... 70 2e-20 >gb|AGE09572.1| cellulose synthase-like protein [Eucalyptus cladocalyx] Length = 979 Score = 75.1 bits (183), Expect(2) = 2e-21 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS +IPIP+++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 153 DASEPLSTLIPIPKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 200 Score = 53.1 bits (126), Expect(2) = 2e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 202 WLTSIICEIWFAYSWVLDQFPK 223 >dbj|BAM05565.1| cellulose synthase 1, partial [Eucalyptus pilularis] gi|383081825|dbj|BAM05566.1| cellulose synthase 1, partial [Eucalyptus pyrocarpa] Length = 962 Score = 75.1 bits (183), Expect(2) = 2e-21 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS +IPIP+++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 150 DASEPLSTLIPIPKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 197 Score = 53.1 bits (126), Expect(2) = 2e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 199 WLTSIICEIWFAYSWVLDQFPK 220 >gb|AAL37718.1|AF413210_1 cellulose synthase A4 [Gossypium hirsutum] Length = 974 Score = 73.2 bits (178), Expect(2) = 4e-21 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 DASQPLS +IPIP+++L YR VIIMRLIIL LFF YRVTHPVD + Sbjct: 153 DASQPLSTIIPIPKSRLAPYRTVIIMRLIILGLFFHYRVTHPVDSA 198 Score = 53.9 bits (128), Expect(2) = 4e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 202 WLTSVICEIWFAFSWVLDQFPK 223 >gb|AFR58754.1| cellulose synthase 1 [Eucalyptus tereticornis] Length = 979 Score = 73.2 bits (178), Expect(2) = 6e-21 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS VIPI +++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 153 DASEPLSTVIPIAKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 200 Score = 53.1 bits (126), Expect(2) = 6e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 202 WLTSIICEIWFAYSWVLDQFPK 223 >gb|AGJ71352.1| cellulose synthase 1 [Eucalyptus urophylla] Length = 978 Score = 73.2 bits (178), Expect(2) = 6e-21 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS VIPI +++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 153 DASEPLSTVIPIAKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 200 Score = 53.1 bits (126), Expect(2) = 6e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 202 WLTSIICEIWFAYSWVLDQFPK 223 >gb|AAY60843.1| cellulose synthase 1 [Eucalyptus grandis] gi|162955784|gb|ABY25276.1| cellulose synthase [Eucalyptus grandis] gi|162955790|gb|ABY25279.1| cellulose synthase [Eucalyptus grandis] Length = 978 Score = 73.2 bits (178), Expect(2) = 6e-21 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS VIPI +++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 153 DASEPLSTVIPIAKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 200 Score = 53.1 bits (126), Expect(2) = 6e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 202 WLTSIICEIWFAYSWVLDQFPK 223 >gb|AEK31215.1| cellulose synthase A [Eucalyptus camaldulensis] Length = 978 Score = 73.2 bits (178), Expect(2) = 6e-21 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS VIPI +++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 153 DASEPLSTVIPIAKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 200 Score = 53.1 bits (126), Expect(2) = 6e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 202 WLTSIICEIWFAYSWVLDQFPK 223 >dbj|BAK14406.1| cellulose synthase catalytic subunit [Eucalyptus globulus] gi|327397147|dbj|BAK14407.1| cellulose synthase catalytic subunit [Eucalyptus globulus] Length = 978 Score = 73.2 bits (178), Expect(2) = 6e-21 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS VIPI +++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 153 DASEPLSTVIPIAKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 200 Score = 53.1 bits (126), Expect(2) = 6e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 202 WLTSIICEIWFAYSWVLDQFPK 223 >dbj|BAM05567.1| cellulose synthase 1, partial [Eucalyptus globulus subsp. globulus] Length = 962 Score = 73.2 bits (178), Expect(2) = 6e-21 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -2 Query: 431 DASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 DAS+PLS VIPI +++L YR VIIMRLIILALFF YRVTHPVD + P Sbjct: 150 DASEPLSTVIPIAKSKLAPYRTVIIMRLIILALFFHYRVTHPVDSAYP 197 Score = 53.1 bits (126), Expect(2) = 6e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA+SWVLDQFPK Sbjct: 199 WLTSIICEIWFAYSWVLDQFPK 220 >ref|XP_002269610.2| PREDICTED: cellulose synthase A catalytic subunit 8 [UDP-forming] [Vitis vinifera] Length = 1360 Score = 74.3 bits (181), Expect(2) = 8e-21 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = -2 Query: 440 RSVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 +S DA+QPLS V+P+PR +LT YR VIIMRLIILALFF YR+T+PVD + Sbjct: 528 QSADAAQPLSTVVPLPRNKLTPYRGVIIMRLIILALFFHYRITNPVDSA 576 Score = 51.6 bits (122), Expect(2) = 8e-21 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA SWVLDQFPK Sbjct: 580 WLTSIICEIWFAVSWVLDQFPK 601 >gb|EYU28107.1| hypothetical protein MIMGU_mgv1a000793mg [Mimulus guttatus] Length = 985 Score = 72.0 bits (175), Expect(2) = 8e-21 Identities = 32/53 (60%), Positives = 45/53 (84%) Frame = -2 Query: 452 KKQCRSVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 +++ +S +A++PLS+V+P+P++QL YR VIIMRLIIL LFF YRVTHPVD + Sbjct: 150 EEKSQSGEAAKPLSRVVPLPKSQLAPYRTVIIMRLIILILFFHYRVTHPVDSA 202 Score = 53.9 bits (128), Expect(2) = 8e-21 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 206 WLTSVICEIWFAFSWVLDQFPK 227 >emb|CBI30712.3| unnamed protein product [Vitis vinifera] Length = 983 Score = 74.3 bits (181), Expect(2) = 8e-21 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = -2 Query: 440 RSVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 +S DA+QPLS V+P+PR +LT YR VIIMRLIILALFF YR+T+PVD + Sbjct: 151 QSADAAQPLSTVVPLPRNKLTPYRGVIIMRLIILALFFHYRITNPVDSA 199 Score = 51.6 bits (122), Expect(2) = 8e-21 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTSIICEIWFA SWVLDQFPK Sbjct: 203 WLTSIICEIWFAVSWVLDQFPK 224 >gb|AEE60894.1| cellulose synthase [Populus tomentosa] Length = 978 Score = 70.9 bits (172), Expect(2) = 2e-20 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 S DAS+PLS V PIPR +LT YRAVIIMRL+IL LFF YR+T+PVD + Sbjct: 152 SGDASEPLSIVYPIPRNKLTPYRAVIIMRLVILGLFFHYRITNPVDSA 199 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 203 WLTSVICEIWFAFSWVLDQFPK 224 >gb|AEE60893.1| cellulose synthase [Populus tomentosa] Length = 978 Score = 70.9 bits (172), Expect(2) = 2e-20 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 S +AS+PLS V PIPR +LT YRAVIIMRLIIL LFF YR+T+PVD + Sbjct: 152 SAEASEPLSIVYPIPRNKLTPYRAVIIMRLIILGLFFHYRITNPVDSA 199 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 203 WLTSVICEIWFAFSWVLDQFPK 224 >ref|XP_002316815.1| hypothetical protein POPTR_0011s07040g [Populus trichocarpa] gi|222859880|gb|EEE97427.1| hypothetical protein POPTR_0011s07040g [Populus trichocarpa] Length = 978 Score = 70.9 bits (172), Expect(2) = 2e-20 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 S +AS+PLS V PIPR +LT YRAVIIMRLIIL LFF YR+T+PVD + Sbjct: 152 SAEASEPLSIVYPIPRNKLTPYRAVIIMRLIILGLFFHYRITNPVDSA 199 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 203 WLTSVICEIWFAFSWVLDQFPK 224 >gb|AAT09896.2| cellulose synthase [Populus tremula x Populus tremuloides] Length = 978 Score = 70.9 bits (172), Expect(2) = 2e-20 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 S +AS+PLS V PIPR +LT YRAVIIMRLIIL LFF YR+T+PVD + Sbjct: 152 SAEASEPLSIVYPIPRNKLTPYRAVIIMRLIILGLFFHYRITNPVDSA 199 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 203 WLTSVICEIWFAFSWVLDQFPK 224 >gb|AFZ78552.1| cellulose synthase [Populus tomentosa] Length = 977 Score = 70.9 bits (172), Expect(2) = 2e-20 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 S +AS+PLS V PIPR +LT YRAVIIMRLIIL LFF YR+T+PVD + Sbjct: 152 SAEASEPLSIVYPIPRNKLTPYRAVIIMRLIILGLFFHYRITNPVDSA 199 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 203 WLTSVICEIWFAFSWVLDQFPK 224 >ref|XP_007025329.1| Cellulose synthase family protein isoform 1 [Theobroma cacao] gi|508780695|gb|EOY27951.1| Cellulose synthase family protein isoform 1 [Theobroma cacao] Length = 980 Score = 70.5 bits (171), Expect(2) = 2e-20 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGSLP 288 + DASQPLS +IPIP+++L+ YR VI+MRL+IL LFF YRVT+PV + P Sbjct: 151 AADASQPLSTIIPIPKSRLSPYRTVIVMRLVILGLFFHYRVTNPVHSAFP 200 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 202 WLTSVICEIWFAFSWVLDQFPK 223 >gb|AFZ78566.1| cellulose synthase [Populus tomentosa] Length = 978 Score = 70.5 bits (171), Expect(2) = 2e-20 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 S +AS+PLS V PIPR +LT YRAVIIMRL+IL LFF YR+T+PVD + Sbjct: 152 SAEASEPLSIVYPIPRNKLTPYRAVIIMRLVILGLFFHYRITNPVDSA 199 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 203 WLTSVICEIWFAFSWVLDQFPK 224 >gb|AAT09897.1| cellulose synthase [Populus tremula x Populus tremuloides] Length = 978 Score = 70.5 bits (171), Expect(2) = 2e-20 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -2 Query: 437 SVDASQPLSKVIPIPRTQLTAYRAVIIMRLIILALFFQYRVTHPVDGS 294 S +AS+PLS V PIPR +LT YRAVIIMRL+IL LFF YR+T+PVD + Sbjct: 152 SAEASEPLSIVYPIPRNKLTPYRAVIIMRLVILGLFFHYRITNPVDSA 199 Score = 53.9 bits (128), Expect(2) = 2e-20 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -1 Query: 300 WLTSIICEIWFAFSWVLDQFPK 235 WLTS+ICEIWFAFSWVLDQFPK Sbjct: 203 WLTSVICEIWFAFSWVLDQFPK 224