BLASTX nr result
ID: Mentha27_contig00026653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026653 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37300.1| hypothetical protein MIMGU_mgv1a022285mg [Mimulus... 57 3e-06 >gb|EYU37300.1| hypothetical protein MIMGU_mgv1a022285mg [Mimulus guttatus] Length = 386 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 2/91 (2%) Frame = -2 Query: 348 GWSKKYEVDMNPISDEGFDMNNVDLHFVNVGDKEEDSMLLFNVLGKLMIYRFHGAKFEVL 169 GW +KY D+NP+S + V + + GDKEEDS +L + G ++ Y F +FEVL Sbjct: 298 GWVEKYRADLNPVSKAIGCLRVVGI--IARGDKEEDSSVLLHAPGTIVRYWFFDKRFEVL 355 Query: 168 ADF--NTFHRDKEGPSSFGNARHFIQSLAPV 82 +F +T +++ E FI+SLAPV Sbjct: 356 CNFASSTIYKEDEFQFETKFCYQFIESLAPV 386