BLASTX nr result
ID: Mentha27_contig00026515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026515 (505 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40294.1| hypothetical protein MIMGU_mgv1a020707mg [Mimulus... 54 4e-08 >gb|EYU40294.1| hypothetical protein MIMGU_mgv1a020707mg [Mimulus guttatus] Length = 167 Score = 54.3 bits (129), Expect(2) = 4e-08 Identities = 29/54 (53%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 74 LQDKWKE-IKEKEQILALVSEETRKAATHKANTRAELSGLRQKVELDIHLKRDE 232 L W++ IKEKE +LA+ EE R A HKAN+RAEL+ LRQK E++ L RD+ Sbjct: 9 LMVSWRQNIKEKEYMLAIRGEEIRTAEIHKANSRAELTKLRQKREMESQLGRDD 62 Score = 28.9 bits (63), Expect(2) = 4e-08 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 9/60 (15%) Frame = +3 Query: 243 LERDLSRLQMFHQF--SNTFLYNGIDVTSPE---PHKHSE----HRNCMKCSVNDVFVVF 395 LE +LSRL++ Q S Y + TS E P SE H CM C N+V VVF Sbjct: 66 LEDELSRLRVSQQMRESGDSSYEDAEATSSESSAPIDSSERSIRHWICMMCLENEVSVVF 125