BLASTX nr result
ID: Mentha27_contig00026497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026497 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40279.1| hypothetical protein MIMGU_mgv1a009338mg [Mimulus... 59 5e-07 >gb|EYU40279.1| hypothetical protein MIMGU_mgv1a009338mg [Mimulus guttatus] Length = 345 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 102 IPFSKGFSPLFGDPNIFPSLDDRSVQLHLNQYTG 1 IPFSKGFSPLFG+ NI S DD+SVQLHLNQ+TG Sbjct: 35 IPFSKGFSPLFGEGNIIHSQDDQSVQLHLNQFTG 68