BLASTX nr result
ID: Mentha27_contig00026054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026054 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37655.1| hypothetical protein MIMGU_mgv1a001940mg [Mimulus... 79 8e-13 gb|EPS59932.1| hypothetical protein M569_14873, partial [Genlise... 67 3e-09 >gb|EYU37655.1| hypothetical protein MIMGU_mgv1a001940mg [Mimulus guttatus] Length = 736 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/56 (66%), Positives = 48/56 (85%) Frame = +1 Query: 7 NIREEFQKHLGGEGPGTALELESVQNLMLEMEKTHSVSQVEIKGLKDELSFIKTSS 174 ++REEF+KHLGG GPGTALELESVQ+LM+EMEK S +VEI+GL +EL+ +K S+ Sbjct: 483 SVREEFEKHLGGAGPGTALELESVQSLMVEMEKKFSTFRVEIEGLNNELNVVKLSN 538 >gb|EPS59932.1| hypothetical protein M569_14873, partial [Genlisea aurea] Length = 176 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/67 (47%), Positives = 45/67 (67%) Frame = +1 Query: 7 NIREEFQKHLGGEGPGTALELESVQNLMLEMEKTHSVSQVEIKGLKDELSFIKTSSQVPD 186 +IREEF+KHLGG GPGTA++LESVQ LM E+E+ H +E++GL+ +L +K Sbjct: 54 SIREEFEKHLGGCGPGTAMKLESVQRLMAEVERKHDGLVMEMEGLRKQLDLVKEQDLAAA 113 Query: 187 FSQLKNE 207 +L E Sbjct: 114 VVELNGE 120