BLASTX nr result
ID: Mentha27_contig00026042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00026042 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 173 2e-41 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 89 8e-16 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 173 bits (439), Expect = 2e-41 Identities = 83/84 (98%), Positives = 83/84 (98%) Frame = -1 Query: 257 NVVRQFGSYLPLVLKGELRGANPSTRGLGWANLWSTGCYANSSAGQLSWYGRTAAQREIL 78 NVVRQFGSYLPLVLKGELRGANPSTRGLGWANLWSTGCYANSSAG LSWYGRTAAQREIL Sbjct: 1 NVVRQFGSYLPLVLKGELRGANPSTRGLGWANLWSTGCYANSSAGLLSWYGRTAAQREIL 60 Query: 77 LYTSSRTRFLNRTSIGERCKHREV 6 LYTSSRTRFLNRTSIGERCKHREV Sbjct: 61 LYTSSRTRFLNRTSIGERCKHREV 84 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 88.6 bits (218), Expect = 8e-16 Identities = 50/85 (58%), Positives = 50/85 (58%) Frame = +2 Query: 2 FTPRGAYTSRLSKFCSKTSSENLYREGFPAAQQFFHTNLAARRCYWHNNR*TIGWPNPVL 181 FTPRGAYTSRLSKFCSKTS ENLYREGFP Sbjct: 366 FTPRGAYTSRLSKFCSKTSFENLYREGFP------------------------------- 394 Query: 182 SY*GWLLAVLPLTPTVDRNRTVSRR 256 GWLLAVLPLTPTVDRNRTVSRR Sbjct: 395 ---GWLLAVLPLTPTVDRNRTVSRR 416