BLASTX nr result
ID: Mentha27_contig00025875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00025875 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39494.1| hypothetical protein MIMGU_mgv1a001769mg [Mimulus... 72 1e-10 >gb|EYU39494.1| hypothetical protein MIMGU_mgv1a001769mg [Mimulus guttatus] Length = 761 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/79 (51%), Positives = 50/79 (63%) Frame = -3 Query: 242 SHADNSEKEDYQSLTRQMARHTLRNKYPLHCFSRVPSLHREIGVHGKVSPMGFRWTTEYV 63 S A +KE SLT+ A+ TL NKY + VP++ REIG V +GFRWTT+Y Sbjct: 53 SGAHWGDKEGLYSLTKHPAQRTLTNKYAGYNCYGVPTMRREIGK--PVEFIGFRWTTDYA 110 Query: 62 RQLSTAPAGKPQLQGGDNK 6 R LSTA AGKP L GGD+K Sbjct: 111 RYLSTAAAGKPVLGGGDDK 129