BLASTX nr result
ID: Mentha27_contig00025619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00025619 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30040.1| hypothetical protein MIMGU_mgv11b021103mg, partia... 55 8e-06 ref|XP_002312427.2| hypothetical protein POPTR_0008s12630g [Popu... 55 8e-06 >gb|EYU30040.1| hypothetical protein MIMGU_mgv11b021103mg, partial [Mimulus guttatus] Length = 80 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = +3 Query: 216 MGDHFVLLVDRLLTESTLEAAIES--RLKHEASIIVDEATIDYS 341 MGDHFVLLVDRLLTESTLEAAIES LK +I+++ ID S Sbjct: 1 MGDHFVLLVDRLLTESTLEAAIESVNSLKRAPPLIIEDTVIDCS 44 >ref|XP_002312427.2| hypothetical protein POPTR_0008s12630g [Populus trichocarpa] gi|550332926|gb|EEE89794.2| hypothetical protein POPTR_0008s12630g [Populus trichocarpa] Length = 267 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = +3 Query: 216 MGDHFVLLVDRLLTESTLEAAIESR-LKHEASI-IVDEATIDYSFHK 350 MGDHFVLLV+RLLTESTLEAAIESR L +A+ VD+ ID SF K Sbjct: 1 MGDHFVLLVNRLLTESTLEAAIESRNLSMQATASTVDDTKIDKSFQK 47