BLASTX nr result
ID: Mentha27_contig00025532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00025532 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31193.1| hypothetical protein MIMGU_mgv1a006993mg [Mimulus... 60 3e-07 gb|EPS69667.1| hypothetical protein M569_05097 [Genlisea aurea] 57 3e-06 ref|XP_004297276.1| PREDICTED: 26S proteasome non-ATPase regulat... 56 6e-06 >gb|EYU31193.1| hypothetical protein MIMGU_mgv1a006993mg [Mimulus guttatus] Length = 423 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 DAIYPATLETISNMEKVVDSLYARSAKIMA 90 DAIYPATLETISNMEKVVDSLYARSAKIMA Sbjct: 394 DAIYPATLETISNMEKVVDSLYARSAKIMA 423 >gb|EPS69667.1| hypothetical protein M569_05097 [Genlisea aurea] Length = 423 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 DAIYPATLETISNMEKVVDSLYARSAKIMA 90 DAIY ATLETISNMEKVVDSLYARSAKIMA Sbjct: 394 DAIYEATLETISNMEKVVDSLYARSAKIMA 423 >ref|XP_004297276.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 11-like [Fragaria vesca subsp. vesca] Length = 422 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 DAIYPATLETISNMEKVVDSLYARSAKIMA 90 DAIYPATLETISNM KVVDSLY RSAKIMA Sbjct: 393 DAIYPATLETISNMGKVVDSLYVRSAKIMA 422