BLASTX nr result
ID: Mentha27_contig00025145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00025145 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027817.1| Alpha/beta-Hydrolases superfamily protein is... 57 2e-06 ref|XP_007027816.1| Alpha/beta-Hydrolases superfamily protein is... 57 2e-06 ref|XP_002282116.1| PREDICTED: abhydrolase domain-containing pro... 57 3e-06 ref|XP_004494209.1| PREDICTED: alpha/beta hydrolase domain-conta... 56 6e-06 ref|XP_004303535.1| PREDICTED: alpha/beta hydrolase domain-conta... 56 6e-06 ref|XP_006373840.1| hypothetical protein POPTR_0016s07800g [Popu... 55 8e-06 ref|XP_002322817.2| hypothetical protein POPTR_0016s07800g [Popu... 55 8e-06 ref|XP_006373838.1| hypothetical protein POPTR_0016s07780g [Popu... 55 8e-06 ref|XP_002323417.2| hypothetical protein POPTR_0016s07740g [Popu... 55 8e-06 ref|XP_002530343.1| valacyclovir hydrolase, putative [Ricinus co... 55 8e-06 ref|XP_006373836.1| hypothetical protein POPTR_0016s07740g [Popu... 55 8e-06 >ref|XP_007027817.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] gi|508716422|gb|EOY08319.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma cacao] Length = 288 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFAQSC N +YG+NV LPKQ Sbjct: 138 GHSMGGKVALQFAQSCVNREYGENVKLPKQ 167 >ref|XP_007027816.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508716421|gb|EOY08318.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 335 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFAQSC N +YG+NV LPKQ Sbjct: 138 GHSMGGKVALQFAQSCVNREYGENVKLPKQ 167 >ref|XP_002282116.1| PREDICTED: abhydrolase domain-containing protein 11 [Vitis vinifera] gi|297740142|emb|CBI30324.3| unnamed protein product [Vitis vinifera] Length = 331 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQKL 272 GHS+GGKVALQFA+SCA GDYG++ +LPKQ L Sbjct: 134 GHSLGGKVALQFAESCARGDYGESAALPKQLL 165 >ref|XP_004494209.1| PREDICTED: alpha/beta hydrolase domain-containing protein 11-like [Cicer arietinum] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFAQSC+ G+YGD+V PKQ Sbjct: 132 GHSMGGKVALQFAQSCSRGEYGDSVQWPKQ 161 >ref|XP_004303535.1| PREDICTED: alpha/beta hydrolase domain-containing protein 11-like [Fragaria vesca subsp. vesca] Length = 322 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFAQSCA G YGD+ LPKQ Sbjct: 124 GHSMGGKVALQFAQSCAAGHYGDHAKLPKQ 153 >ref|XP_006373840.1| hypothetical protein POPTR_0016s07800g [Populus trichocarpa] gi|550321069|gb|ERP51637.1| hypothetical protein POPTR_0016s07800g [Populus trichocarpa] Length = 336 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFA+SC GDYG +VS PKQ Sbjct: 138 GHSMGGKVALQFAESCTRGDYGHSVSFPKQ 167 >ref|XP_002322817.2| hypothetical protein POPTR_0016s07800g [Populus trichocarpa] gi|550321068|gb|EEF04578.2| hypothetical protein POPTR_0016s07800g [Populus trichocarpa] Length = 320 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFA+SC GDYG +VS PKQ Sbjct: 122 GHSMGGKVALQFAESCTRGDYGHSVSFPKQ 151 >ref|XP_006373838.1| hypothetical protein POPTR_0016s07780g [Populus trichocarpa] gi|550321066|gb|ERP51635.1| hypothetical protein POPTR_0016s07780g [Populus trichocarpa] Length = 204 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFA+SC GDYG +VS PKQ Sbjct: 137 GHSMGGKVALQFAESCTRGDYGHSVSFPKQ 166 >ref|XP_002323417.2| hypothetical protein POPTR_0016s07740g [Populus trichocarpa] gi|550321062|gb|EEF05178.2| hypothetical protein POPTR_0016s07740g [Populus trichocarpa] Length = 177 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFA+SC GDYG +VS PKQ Sbjct: 110 GHSMGGKVALQFAESCTRGDYGHSVSFPKQ 139 >ref|XP_002530343.1| valacyclovir hydrolase, putative [Ricinus communis] gi|223530147|gb|EEF32059.1| valacyclovir hydrolase, putative [Ricinus communis] Length = 317 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFA SCA GDYG +V+ PKQ Sbjct: 119 GHSMGGKVALQFANSCARGDYGQSVAFPKQ 148 >ref|XP_006373836.1| hypothetical protein POPTR_0016s07740g [Populus trichocarpa] gi|550321063|gb|ERP51633.1| hypothetical protein POPTR_0016s07740g [Populus trichocarpa] Length = 179 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 367 GHSMGGKVALQFAQSCANGDYGDNVSLPKQ 278 GHSMGGKVALQFA+SC GDYG +VS PKQ Sbjct: 112 GHSMGGKVALQFAESCTRGDYGHSVSFPKQ 141