BLASTX nr result
ID: Mentha27_contig00025141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00025141 (753 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007143895.1| hypothetical protein PHAVU_007G111200g [Phas... 57 5e-06 gb|EYU41429.1| hypothetical protein MIMGU_mgv1a021942mg [Mimulus... 57 9e-06 gb|EYU26972.1| hypothetical protein MIMGU_mgv1a019086mg [Mimulus... 57 9e-06 >ref|XP_007143895.1| hypothetical protein PHAVU_007G111200g [Phaseolus vulgaris] gi|561017085|gb|ESW15889.1| hypothetical protein PHAVU_007G111200g [Phaseolus vulgaris] Length = 118 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 3 ETDAEEELKEAFKVFDKDQNGYISADEV*ITPFV 104 +TDAEEELKEAFKVFDKDQNGYISA EV I F+ Sbjct: 81 DTDAEEELKEAFKVFDKDQNGYISASEVCIYLFI 114 >gb|EYU41429.1| hypothetical protein MIMGU_mgv1a021942mg [Mimulus guttatus] Length = 151 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 ETDAEEELKEAFKVFDKDQNGYISADEV 86 E+DAEEELKEAFKVFDKDQNGYISADE+ Sbjct: 80 ESDAEEELKEAFKVFDKDQNGYISADEL 107 >gb|EYU26972.1| hypothetical protein MIMGU_mgv1a019086mg [Mimulus guttatus] Length = 151 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +3 Query: 3 ETDAEEELKEAFKVFDKDQNGYISADEV 86 E+DAEEELKEAFKVFDKDQNGYISADE+ Sbjct: 80 ESDAEEELKEAFKVFDKDQNGYISADEL 107