BLASTX nr result
ID: Mentha27_contig00023402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00023402 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB52672.1| Dihydrodipicolinate synthase 2 [Morus notabilis] 56 5e-06 dbj|BAK03225.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 5e-06 ref|XP_006472249.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate ... 56 6e-06 ref|XP_006433583.1| hypothetical protein CICLE_v10001621mg [Citr... 56 6e-06 ref|XP_006433582.1| hypothetical protein CICLE_v10001621mg [Citr... 56 6e-06 ref|XP_003580363.1| PREDICTED: dihydrodipicolinate synthase 2, c... 56 6e-06 ref|XP_002437401.1| hypothetical protein SORBIDRAFT_10g026260 [S... 56 6e-06 emb|CAK18842.1| dihydropicolinate synthase (DHDPS) precursor [Ph... 55 8e-06 >gb|EXB52672.1| Dihydrodipicolinate synthase 2 [Morus notabilis] Length = 365 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 +VK IGRENFVGEK+V+VLDDDDF+L+DRY Sbjct: 336 LVKKIGRENFVGEKDVKVLDDDDFILVDRY 365 >dbj|BAK03225.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 377 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 IV+ IGRENFVG+KEVQVLDDDDFVLI RY Sbjct: 348 IVEAIGRENFVGQKEVQVLDDDDFVLISRY 377 >ref|XP_006472249.1| PREDICTED: 4-hydroxy-tetrahydrodipicolinate synthase, chloroplastic-like [Citrus sinensis] Length = 359 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 +V IGRENFVGEK+VQVLDDDDF+L+DRY Sbjct: 330 LVNQIGRENFVGEKDVQVLDDDDFILVDRY 359 >ref|XP_006433583.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] gi|557535705|gb|ESR46823.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] Length = 359 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 +V IGRENFVGEK+VQVLDDDDF+L+DRY Sbjct: 330 LVNQIGRENFVGEKDVQVLDDDDFILVDRY 359 >ref|XP_006433582.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] gi|557535704|gb|ESR46822.1| hypothetical protein CICLE_v10001621mg [Citrus clementina] Length = 346 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 +V IGRENFVGEK+VQVLDDDDF+L+DRY Sbjct: 317 LVNQIGRENFVGEKDVQVLDDDDFILVDRY 346 >ref|XP_003580363.1| PREDICTED: dihydrodipicolinate synthase 2, chloroplastic-like [Brachypodium distachyon] Length = 376 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 IV+ IGRENFVGEKEV+VLDDDDFVLI RY Sbjct: 347 IVEAIGRENFVGEKEVRVLDDDDFVLISRY 376 >ref|XP_002437401.1| hypothetical protein SORBIDRAFT_10g026260 [Sorghum bicolor] gi|241915624|gb|EER88768.1| hypothetical protein SORBIDRAFT_10g026260 [Sorghum bicolor] Length = 383 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 IV+ IGRENFVGEKE QVLDDDDFVLI RY Sbjct: 354 IVEAIGRENFVGEKEAQVLDDDDFVLISRY 383 >emb|CAK18842.1| dihydropicolinate synthase (DHDPS) precursor [Phillyrea latifolia] Length = 78 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 409 IVKGIGRENFVGEKEVQVLDDDDFVLIDRY 320 IVK +GRENFVGEK+VQVLDDDDF+LI RY Sbjct: 49 IVKELGRENFVGEKDVQVLDDDDFILIGRY 78