BLASTX nr result
ID: Mentha27_contig00023284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00023284 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB49810.1| putative methyltransferase PMT21 [Morus notabilis] 55 8e-06 ref|XP_004300143.1| PREDICTED: probable methyltransferase PMT20-... 55 8e-06 >gb|EXB49810.1| putative methyltransferase PMT21 [Morus notabilis] Length = 606 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 260 WGCRKEDNERGDLNEKILICQKELWYSSTKNS 165 WGCRKED E G EKILICQK+LWYSS K+S Sbjct: 574 WGCRKEDTEYGVEKEKILICQKKLWYSSNKSS 605 >ref|XP_004300143.1| PREDICTED: probable methyltransferase PMT20-like [Fragaria vesca subsp. vesca] Length = 601 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -3 Query: 260 WGCRKEDNERGDLNEKILICQKELWYSSTKNS 165 WGCRKED E G EKILICQK+LWYSS +NS Sbjct: 569 WGCRKEDTEYGIDKEKILICQKKLWYSSNQNS 600