BLASTX nr result
ID: Mentha27_contig00023189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00023189 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27609.1| hypothetical protein MIMGU_mgv1a0053431mg, partia... 60 2e-07 >gb|EYU27609.1| hypothetical protein MIMGU_mgv1a0053431mg, partial [Mimulus guttatus] Length = 179 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = +2 Query: 341 PESYSARIPGLSSTTPTRSYGPPGVDVAPSAAYNDPLYAGLKRTSAESLYHQTL 502 PESYS RIPG+S+ S+GPPGVD AA D LY LKR S ESLYHQTL Sbjct: 59 PESYSTRIPGVSA----HSHGPPGVD----AASTDALYNELKRASTESLYHQTL 104