BLASTX nr result
ID: Mentha27_contig00022890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00022890 (696 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007590579.1| hypothetical protein CFIO01_09468 [Colletotr... 57 8e-06 >ref|XP_007590579.1| hypothetical protein CFIO01_09468 [Colletotrichum fioriniae PJ7] gi|588906182|gb|EXF85778.1| hypothetical protein CFIO01_09468 [Colletotrichum fioriniae PJ7] Length = 118 Score = 56.6 bits (135), Expect = 8e-06 Identities = 40/108 (37%), Positives = 54/108 (50%), Gaps = 4/108 (3%) Frame = -2 Query: 641 LSAALAVLALGISSVSAQNACAEIVAVTGQTVKSRFNFQSLSGTTWQWRSAQRGSSVFLA 462 LSA A +A+ SV A CA+ A RF S TWQW S +G+++ L Sbjct: 7 LSATAAAMAV---SVQAGGQCADRTASGDAITGFRF---SPGCNTWQWYSRDKGTTITLN 60 Query: 461 QNCLLRQEY-GSFDLTRICIET-SIGNKCFNAPARNDR--CQLPMSYC 330 +C LRQ + + +CI S GNKCF AP ND+ C +P +C Sbjct: 61 PDCQLRQAWPNPTAVGYVCIRNKSGGNKCFAAPTANDQNFCGIPADWC 108