BLASTX nr result
ID: Mentha27_contig00022704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00022704 (502 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46649.1| hypothetical protein MIMGU_mgv1a004791mg [Mimulus... 72 6e-11 >gb|EYU46649.1| hypothetical protein MIMGU_mgv1a004791mg [Mimulus guttatus] Length = 510 Score = 72.4 bits (176), Expect = 6e-11 Identities = 38/64 (59%), Positives = 46/64 (71%) Frame = +3 Query: 48 DRAFPPHNSREQSVFNRRSYSLNASSEPTELSRGRVYLHREADVTSAPVCHRYSFAGPSL 227 DRA REQS FN+R YSL+AS EP+ L +G ++ RE ++TSAPV RYSFAGPS Sbjct: 448 DRAVGSRTLREQSTFNQRPYSLDASREPSVLHQG-FHIQREIELTSAPVSSRYSFAGPSP 506 Query: 228 SQHR 239 SQHR Sbjct: 507 SQHR 510